BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0175.0018.p (204 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_373095.1| hypothetical protein [Staphylococcus aureus sub... 72 1e-11 ref|NP_980994.1| transcriptional regulator, TetR family [Bacillu... 69 8e-11 ref|NP_658599.1| tetR, Bacterial regulatory proteins, tetR famil... 69 8e-11 ref|NP_834276.1| Transcriptional regulator, TetR family [Bacillu... 69 8e-11 ref|NP_815047.1| transcriptional regulator, TetR family [Enteroc... 65 9e-10 >ref|NP_373095.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_375683.1| hypothetical protein, similar to transcriptional regulator (TetR/AcrR family) [Staphylococcus aureus subsp. aureus N315] ref|NP_647309.1| ORFID:MW2492~hypothetical protein, similar to transcriptional regulator (TetR/AcrR family) [Staphylococcus aureus subsp. aureus MW2] pir||D90062 hypothetical protein SA2358 [imported] - Staphylococcus aureus (strain N315) dbj|BAB43662.1| SA2358 [Staphylococcus aureus subsp. aureus N315] dbj|BAB58733.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB96357.1| MW2492 [Staphylococcus aureus subsp. aureus MW2] Length = 189 Score = 71.6 bits (174), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 39/96 (40%), Positives = 58/96 (60%), Gaps = 10/96 (10%) Query: 15 DPRVIRTRQLILDAFVRQLNVMDFNSITVGDITKAATINRATFYAHFQDK-----YALFE 69 DPR++RT+QL++DAF++ + ITV DIT AT+NRATFYAHF DK Y L Sbjct: 8 DPRIVRTKQLLVDAFLKISREKKLSQITVKDITDIATLNRATFYAHFTDKEDLLDYTLSV 67 Query: 70 AFLLDAFTNLVLNKIDTEGPLTEKTLQELIVALCNY 105 L D NL ++ + + EK L+ + +++ +Y Sbjct: 68 TILKDLNDNLSISNV-----INEKVLRNIFISIASY 98 >ref|NP_980994.1| transcriptional regulator, TetR family [Bacillus cereus ATCC 10987] gb|AAS43602.1| transcriptional regulator, TetR family [Bacillus cereus ATCC 10987] Length = 205 Score = 68.6 bits (166), Expect = 8e-11, Method: Compositional matrix adjust. Identities = 35/75 (46%), Positives = 47/75 (62%), Gaps = 3/75 (4%) Query: 12 NPNDPRVIRTRQLILDAFVRQLNVMDFNSITVGDITKAATINRATFYAHFQDKYALFEAF 71 N NDPRV RTRQLI DAFV + F ++TV I + A +NRATFY+H+ DKY L + Sbjct: 5 NTNDPRVKRTRQLIQDAFVALVGEKGFENVTVQHIAERAPVNRATFYSHYHDKYDLLDKS 64 Query: 72 ---LLDAFTNLVLNK 83 +L+ T ++ K Sbjct: 65 IEEMLEKLTKVIKQK 79 >ref|NP_658599.1| tetR, Bacterial regulatory proteins, tetR family [Bacillus anthracis A2012] ref|NP_847017.1| transcriptional regulator, TetR family [Bacillus anthracis str. Ames] gb|AAP28503.1| transcriptional regulator, TetR family [Bacillus anthracis str. Ames] Length = 205 Score = 68.6 bits (166), Expect = 8e-11, Method: Compositional matrix adjust. Identities = 32/58 (55%), Positives = 40/58 (68%) Query: 12 NPNDPRVIRTRQLILDAFVRQLNVMDFNSITVGDITKAATINRATFYAHFQDKYALFE 69 N NDPRV RTRQLI DAFV + F ++TV I + A +NRATFY+H+ DKY L + Sbjct: 5 NTNDPRVKRTRQLIQDAFVALVGEKGFENVTVQHIAERAPVNRATFYSHYHDKYDLLD 62 >ref|NP_834276.1| Transcriptional regulator, TetR family [Bacillus cereus ATCC 14579] gb|AAP11477.1| Transcriptional regulator, TetR family [Bacillus cereus ATCC 14579] Length = 205 Score = 68.6 bits (166), Expect = 8e-11, Method: Compositional matrix adjust. Identities = 32/58 (55%), Positives = 40/58 (68%) Query: 12 NPNDPRVIRTRQLILDAFVRQLNVMDFNSITVGDITKAATINRATFYAHFQDKYALFE 69 N NDPRV RTRQLI DAFV + F ++TV I + A +NRATFY+H+ DKY L + Sbjct: 5 NTNDPRVKRTRQLIQDAFVALVGEKGFENVTVQHIAERAPVNRATFYSHYHDKYDLLD 62 >ref|NP_815047.1| transcriptional regulator, TetR family [Enterococcus faecalis V583] gb|AAO81117.1| transcriptional regulator, TetR family [Enterococcus faecalis V583] Length = 202 Score = 65.1 bits (157), Expect = 9e-10, Method: Compositional matrix adjust. Identities = 32/73 (43%), Positives = 47/73 (64%), Gaps = 3/73 (4%) Query: 11 PNPNDPRVIRTRQLILDAFVRQLNVMDFNSITVGDITKAATINRATFYAHFQDKYALFEA 70 D RV RTR++I++AF + + + ++T+ DI A INRATFYAHF+DK L++A Sbjct: 2 AKKTDLRVQRTRKMIIEAFFKLVETKGYEAVTIQDIADEAMINRATFYAHFKDKQHLYDA 61 Query: 71 ---FLLDAFTNLV 80 F L AFT ++ Sbjct: 62 IFTFTLSAFTAIL 74 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.323 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 240,856,265 Number of extensions: 7477459 Number of successful extensions: 18774 Number of sequences better than 1.0e-05: 21 Number of HSP's gapped: 18789 Number of HSP's successfully gapped: 21 Length of query: 204 Length of database: 757,237,578 Length adjustment: 120 Effective length of query: 84 Effective length of database: 431,425,698 Effective search space: 36239758632 Effective search space used: 36239758632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 123 (52.0 bits)