BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0175.0004.p (208 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||S32217 hypothetical protein 2 - Bacillus megaterium >gi|288... 143 2e-33 ref|NP_844694.1| PAP2 family protein [Bacillus anthracis str. Am... 89 7e-17 ref|NP_978652.1| PAP2 family protein [Bacillus cereus ATCC 10987... 89 9e-17 ref|NP_832023.1| Phosphatidylglycerophosphatase B [Bacillus cere... 87 2e-16 ref|NP_764664.1| conserved hypothetical protein [Staphylococcus ... 74 2e-12 >pir||S32217 hypothetical protein 2 - Bacillus megaterium emb|CAA79986.1| ORF2 [Bacillus megaterium] Length = 216 Score = 143 bits (361), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 74/132 (56%), Positives = 95/132 (71%) Query: 42 FDNFMIHTVQSAESPGLTSLAKGLSLIGSSKLAIGISLLAMVLLYFVLKHRIELILFLAV 101 FD +I VQ ESP LT + K + IGS+ I +SL+ + LY +LKHR+EL+LF AV Sbjct: 36 FDEDVISLVQGWESPLLTDIMKFFTYIGSTASLIILSLVILFFLYRILKHRLELVLFTAV 95 Query: 102 GAGSQLLNTWMKLWFHRERPNIHRLIEQAGYSFPSGHSMAAFSLYGIIAYLLWRHMRRRS 161 GS LLN +KL+F R RP++HRLI+ GYSFPSGH+M AFSLYGI+ +LLWRH+ R Sbjct: 96 MVGSPLLNLMVKLFFQRARPDLHRLIDIGGYSFPSGHAMNAFSLYGILTFLLWRHITARW 155 Query: 162 ERILFILFTVLM 173 RIL ILF++LM Sbjct: 156 ARILLILFSMLM 167 >ref|NP_844694.1| PAP2 family protein [Bacillus anthracis str. Ames] gb|AAP26180.1| PAP2 family protein [Bacillus anthracis str. Ames] Length = 213 Score = 89.0 bits (219), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 49/132 (37%), Positives = 78/132 (59%), Gaps = 3/132 (2%) Query: 39 ISGFDNFMIHTVQSAESPGLTSLAKGLSLIGSSKLAIGISLLAMVLLYFVLKHRIELILF 98 I FDN + H +QS + LT+ +S IGS + I LL ++++YF+++ ++ L Sbjct: 32 IEKFDNIVAHFIQSFRNDYLTTYFTWMSFIGSKR--IYFPLLIILVMYFLVRKKLLSALL 89 Query: 99 LAVGA-GSQLLNTWMKLWFHRERPNIHRLIEQAGYSFPSGHSMAAFSLYGIIAYLLWRHM 157 L + GS+ LN+ +KLW+ R RP++ +L+ GYSFPSGH+M A + G IAY+ Sbjct: 90 LTINYYGSRYLNSMLKLWYERARPDVTQLVTATGYSFPSGHTMNATAFLGFIAYVTITEE 149 Query: 158 RRRSERILFILF 169 R + L I+F Sbjct: 150 RITLHKKLLIIF 161 >ref|NP_978652.1| PAP2 family protein [Bacillus cereus ATCC 10987] gb|AAS41260.1| PAP2 family protein [Bacillus cereus ATCC 10987] Length = 213 Score = 88.6 bits (218), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 49/132 (37%), Positives = 78/132 (59%), Gaps = 3/132 (2%) Query: 39 ISGFDNFMIHTVQSAESPGLTSLAKGLSLIGSSKLAIGISLLAMVLLYFVLKHRIELILF 98 I FDN + H +QS + LT+ +S IGS + I LL ++++YF+++ ++ L Sbjct: 32 IEKFDNIVAHFIQSFRNDYLTAYFTWVSFIGSKR--IYFPLLIILVMYFLVRKKLLSALL 89 Query: 99 LAVGA-GSQLLNTWMKLWFHRERPNIHRLIEQAGYSFPSGHSMAAFSLYGIIAYLLWRHM 157 L + GS+ LN+ +KLW+ R RP++ +L+ GYSFPSGH+M A + G IAY+ Sbjct: 90 LTINYYGSRYLNSMLKLWYERARPDVTQLVTATGYSFPSGHTMNATAFLGFIAYVTITEE 149 Query: 158 RRRSERILFILF 169 R + L I+F Sbjct: 150 RITLHKKLLIIF 161 >ref|NP_832023.1| Phosphatidylglycerophosphatase B [Bacillus cereus ATCC 14579] gb|AAP09224.1| Phosphatidylglycerophosphatase B [Bacillus cereus ATCC 14579] Length = 213 Score = 87.0 bits (214), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 45/115 (39%), Positives = 72/115 (62%), Gaps = 3/115 (2%) Query: 39 ISGFDNFMIHTVQSAESPGLTSLAKGLSLIGSSKLAIGISLLAMVLLYFVLKHRIELILF 98 I FDN + H +QS + LT+ +S IGS + I LL ++++YF+++ ++ L Sbjct: 32 IENFDNIVAHFIQSFRNDYLTTYFTWVSFIGSKR--IYFPLLIILVMYFLVRKKLLSALL 89 Query: 99 LAVGA-GSQLLNTWMKLWFHRERPNIHRLIEQAGYSFPSGHSMAAFSLYGIIAYL 152 L + GS+ LN+ +KLW+ R RP++ +L+ GYSFPSGH+M A + G IAY+ Sbjct: 90 LTINYYGSRYLNSMLKLWYERARPDVTQLVTATGYSFPSGHTMNATAFLGFIAYV 144 >ref|NP_764664.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] gb|AAO04706.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] Length = 204 Score = 73.9 bits (180), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 45/115 (39%), Positives = 69/115 (60%), Gaps = 3/115 (2%) Query: 43 DNFMIHTVQSAESPGLTSLAKGLSLIGSSKLAIGISLLAMVLLYFVLKH-RIELILFLAV 101 DN + + S+ES TS+ G++ IG + +SLL + Y +LK +IE + F+ V Sbjct: 33 DNEVYEFIYSSESFITTSIMLGVTKIGEVWAMVALSLLLVA--YLMLKRFKIETLFFVIV 90 Query: 102 GAGSQLLNTWMKLWFHRERPNIHRLIEQAGYSFPSGHSMAAFSLYGIIAYLLWRH 156 + S LN +K F RERP + RLI+ +G+SFPSGH+M + S +G Y++ RH Sbjct: 91 MSLSSTLNPLLKNIFDRERPTLLRLIDISGFSFPSGHAMGSTSFFGSAIYVINRH 145 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.327 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 274,940,178 Number of extensions: 9423351 Number of successful extensions: 30731 Number of sequences better than 1.0e-05: 48 Number of HSP's gapped: 30729 Number of HSP's successfully gapped: 48 Length of query: 208 Length of database: 757,237,578 Length adjustment: 120 Effective length of query: 88 Effective length of database: 431,425,698 Effective search space: 37965461424 Effective search space used: 37965461424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 123 (52.0 bits)