BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0172.0002.p (95 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_389363.1| similar to hypothetical proteins from B. subtil... 103 2e-21 ref|NP_656632.1| hypothetical protein predicted by GeneMark [Bac... 92 4e-18 ref|NP_832503.1| IG hypothetical 17041 [Bacillus cereus ATCC 145... 92 4e-18 ref|NP_979083.1| lipoprotein, putative [Bacillus cereus ATCC 109... 92 5e-18 ref|NP_623255.1| hypothetical protein [Thermoanaerobacter tengco... 53 2e-06 >ref|NP_389363.1| similar to hypothetical proteins from B. subtilis [Bacillus subtilis] sp|O07634|YLAJ_BACSU Hypothetical lipoprotein ylaJ precursor pir||H69872 conserved hypothetical protein ylaJ - Bacillus subtilis emb|CAB09715.1| ylaJ [Bacillus subtilis] emb|CAB13353.1| ylaJ [Bacillus subtilis subsp. subtilis str. 168] Length = 209 Score = 103 bits (256), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 50/88 (56%), Positives = 64/88 (72%) Query: 1 VVMNNVAVVGIDVDGTLTRSRVGNIKYSVAEAIRKDPRGVKALVTADMDISSRLAEMGRH 60 VV+ AVVGIDVD TL RS+V IKYSVA+A++ D G A+V AD D SRL EM R Sbjct: 79 VVLGGYAVVGIDVDDTLDRSKVETIKYSVAQALKNDRYGANAVVIADPDTVSRLREMSRE 138 Query: 61 ISKGHPVSGFASEMADIIGRIIPQLPGD 88 IS+GHPV+G E+A I+GR++P++P D Sbjct: 139 ISEGHPVTGILDELAAIVGRVLPEVPND 166 >ref|NP_656632.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_845096.1| lipoprotein, putative [Bacillus anthracis str. Ames] gb|AAP26582.1| lipoprotein, putative [Bacillus anthracis str. Ames] Length = 198 Score = 91.7 bits (226), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 43/88 (48%), Positives = 60/88 (68%) Query: 1 VVMNNVAVVGIDVDGTLTRSRVGNIKYSVAEAIRKDPRGVKALVTADMDISSRLAEMGRH 60 VV+ A+VGIDV L R+RV +IKYSVAE+++ DP G A+V AD+D RL ++G+ Sbjct: 72 VVVGKYAIVGIDVKAKLDRTRVESIKYSVAESLKNDPDGANAVVVADVDTYERLKQIGKQ 131 Query: 61 ISKGHPVSGFASEMADIIGRIIPQLPGD 88 I KG G E+A I+GR++PQ+P D Sbjct: 132 IKKGKTGEGILDELAAIVGRVMPQVPND 159 >ref|NP_832503.1| IG hypothetical 17041 [Bacillus cereus ATCC 14579] gb|AAP09704.1| IG hypothetical 17041 [Bacillus cereus ATCC 14579] Length = 196 Score = 91.7 bits (226), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 43/88 (48%), Positives = 60/88 (68%) Query: 1 VVMNNVAVVGIDVDGTLTRSRVGNIKYSVAEAIRKDPRGVKALVTADMDISSRLAEMGRH 60 VV+ A+VGIDV L R+RV +IKYSVAE+++ DP G A+V AD+D RL ++G+ Sbjct: 75 VVVGKYAIVGIDVKAKLDRTRVESIKYSVAESLKNDPDGANAVVVADVDTYERLKQIGKQ 134 Query: 61 ISKGHPVSGFASEMADIIGRIIPQLPGD 88 I KG G E+A I+GR++PQ+P D Sbjct: 135 IKKGKTGEGILDELAAIVGRVMPQVPND 162 >ref|NP_979083.1| lipoprotein, putative [Bacillus cereus ATCC 10987] gb|AAS41691.1| lipoprotein, putative [Bacillus cereus ATCC 10987] Length = 198 Score = 91.7 bits (226), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 43/88 (48%), Positives = 60/88 (68%) Query: 1 VVMNNVAVVGIDVDGTLTRSRVGNIKYSVAEAIRKDPRGVKALVTADMDISSRLAEMGRH 60 VV+ A+VGIDV L R+RV +IKYSVAE+++ DP G A+V AD+D RL ++G+ Sbjct: 72 VVVGKYAIVGIDVKAKLDRTRVESIKYSVAESLKNDPDGANAVVVADVDTYERLKQIGKQ 131 Query: 61 ISKGHPVSGFASEMADIIGRIIPQLPGD 88 I KG G E+A I+GR++PQ+P D Sbjct: 132 IKKGKTGEGILDELAAIVGRVMPQVPND 159 >ref|NP_623255.1| hypothetical protein [Thermoanaerobacter tengcongensis] gb|AAM24859.1| hypothetical protein [Thermoanaerobacter tengcongensis] Length = 171 Score = 53.1 bits (126), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 27/84 (32%), Positives = 50/84 (59%), Gaps = 1/84 (1%) Query: 1 VVMNNVAVVGIDVDGTLTRSRVGNIKYSVAEAIRKDPRGV-KALVTADMDISSRLAEMGR 59 V+ A+VG+D+ + + ++K + +A++ + + + VTAD D+ R+ + R Sbjct: 86 VISGTTALVGVDMKAKVQGTHEKDVKKKIEKAVKDTDKSITRVYVTADPDLYKRIDNIAR 145 Query: 60 HISKGHPVSGFASEMADIIGRIIP 83 IS+G PVS FA ++++II RI P Sbjct: 146 GISEGRPVSEFAKQISEIIKRITP 169 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.136 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 136,394,877 Number of extensions: 4532348 Number of successful extensions: 11065 Number of sequences better than 1.0e-05: 5 Number of HSP's gapped: 11065 Number of HSP's successfully gapped: 5 Length of query: 95 Length of database: 757,237,578 Length adjustment: 63 Effective length of query: 32 Effective length of database: 586,186,341 Effective search space: 18757962912 Effective search space used: 18757962912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)