BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0168.0018.p (115 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_654914.1| hypothetical protein predicted by GeneMark [Bac... 91 1e-17 ref|NP_977403.1| conserved hypothetical protein [Bacillus cereus... 90 1e-17 ref|NP_830784.1| General stress protein 17M [Bacillus cereus ATC... 90 1e-17 ref|NP_388636.1| yflT [Bacillus subtilis] >gi|6016069|sp|P80241|... 89 2e-17 ref|NP_657046.1| hypothetical protein predicted by GeneMark [Bac... 80 1e-14 >ref|NP_654914.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_843487.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP24973.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 129 Score = 90.5 bits (223), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 41/88 (46%), Positives = 61/88 (69%) Query: 24 NRLLGSGYTRDDLYVISHNEDREGRIADAADTNEVGLHEEGLFGAIANMFRSRGDALRNK 83 N L+ G + D+YV++H ++R RIAD AD N +G+ EEGL +I N+F++ GD LRNK Sbjct: 24 NDLVKKGIDQKDIYVLTHEKERTDRIADNADVNTIGIKEEGLGTSIINVFQNTGDQLRNK 83 Query: 84 ITSLGFSAAEAAYYEKELDSGKVLVIAK 111 + LG + EA +YE++LD GK+L+ K Sbjct: 84 MQELGLNEEEANFYEEKLDEGKILLFVK 111 >ref|NP_977403.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS40011.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 129 Score = 90.1 bits (222), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 41/88 (46%), Positives = 60/88 (68%) Query: 24 NRLLGSGYTRDDLYVISHNEDREGRIADAADTNEVGLHEEGLFGAIANMFRSRGDALRNK 83 N L+ G + D+YV++H ++R RIAD AD N +G+ EEGL +I N+F+ GD LRNK Sbjct: 24 NDLVKKGIDQKDIYVLTHEKERTDRIADNADVNTIGIKEEGLGTSIINVFQKTGDQLRNK 83 Query: 84 ITSLGFSAAEAAYYEKELDSGKVLVIAK 111 + LG + EA +YE++LD GK+L+ K Sbjct: 84 MQELGLNEEEANFYEEKLDEGKILLFVK 111 >ref|NP_830784.1| General stress protein 17M [Bacillus cereus ATCC 14579] gb|AAP07985.1| General stress protein 17M [Bacillus cereus ATCC 14579] Length = 129 Score = 90.1 bits (222), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 41/88 (46%), Positives = 60/88 (68%) Query: 24 NRLLGSGYTRDDLYVISHNEDREGRIADAADTNEVGLHEEGLFGAIANMFRSRGDALRNK 83 N L+ G + D+YV++H ++R RIAD AD N +G+ EEGL +I N+F+ GD LRNK Sbjct: 24 NDLVKKGIEQKDIYVLTHEKERTDRIADNADVNTIGIKEEGLGTSIINVFQKTGDQLRNK 83 Query: 84 ITSLGFSAAEAAYYEKELDSGKVLVIAK 111 + LG + EA +YE++LD GK+L+ K Sbjct: 84 MQELGLNEEEANFYEEKLDEGKILLFVK 111 >ref|NP_388636.1| yflT [Bacillus subtilis] sp|P80241|G17M_BACSU General stress protein 17M (GSP17M) pir||G69811 hypothetical protein yflT - Bacillus subtilis dbj|BAA22314.1| YflT [Bacillus subtilis] emb|CAB12584.1| yflT [Bacillus subtilis subsp. subtilis str. 168] Length = 115 Score = 89.4 bits (220), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 43/99 (43%), Positives = 62/99 (62%) Query: 15 NGIQAIEEVNRLLGSGYTRDDLYVISHNEDREGRIADAADTNEVGLHEEGLFGAIANMFR 74 N Q +++V L G ++D+YV++H++DR R+AD + N +G E G A+ N+F Sbjct: 10 NDEQLMKDVEELQKMGVAKEDVYVLAHDDDRTERLADNTNANTIGAKETGFKHAVGNIFN 69 Query: 75 SRGDALRNKITSLGFSAAEAAYYEKELDSGKVLVIAKKN 113 +GD LRNKI +GFS EAA +EK LD GKVL+ N Sbjct: 70 KKGDELRNKIHEIGFSEDEAAQFEKRLDEGKVLLFVTDN 108 >ref|NP_657046.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_845486.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP26972.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 128 Score = 80.5 bits (197), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 37/97 (38%), Positives = 61/97 (62%) Query: 14 ENGIQAIEEVNRLLGSGYTRDDLYVISHNEDREGRIADAADTNEVGLHEEGLFGAIANMF 73 EN + + +V L G +DD+YV++H + +IAD +TN +G+ E+GL +I N F Sbjct: 14 ENEQEVVMKVKELELQGIHQDDIYVLTHEKHLTKKIADDTNTNTIGVKEQGLGTSIINFF 73 Query: 74 RSRGDALRNKITSLGFSAAEAAYYEKELDSGKVLVIA 110 +GD LRN++ +G S EA YE++LD G++L++ Sbjct: 74 SKKGDELRNQMEEMGLSKEEANLYEEKLDQGRILLLV 110 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.133 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 154,842,405 Number of extensions: 5598093 Number of successful extensions: 10911 Number of sequences better than 1.0e-05: 8 Number of HSP's gapped: 10911 Number of HSP's successfully gapped: 8 Length of query: 115 Length of database: 757,237,578 Length adjustment: 80 Effective length of query: 35 Effective length of database: 540,029,658 Effective search space: 18901038030 Effective search space used: 18901038030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 120 (50.8 bits)