BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0162.0010.p (114 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_389687.1| yneQ [Bacillus subtilis] >gi|7475199|pir||G6989... 128 5e-29 ref|NP_692606.1| hypothetical protein OB1685 [Oceanobacillus ihe... 126 2e-28 ref|NP_243152.1| BH2286~unknown conserved protein in B. subtilis... 122 3e-27 ref|NP_470657.1| similar to B. subtilis YneQ protein [Listeria i... 119 3e-26 ref|NP_464807.1| similar to B. subtilis YneQ protein [Listeria m... 118 5e-26 >ref|NP_389687.1| yneQ [Bacillus subtilis] pir||G69891 hypothetical protein yneQ - Bacillus subtilis emb|CAA97602.1| YneQ [Bacillus subtilis] emb|CAB13688.1| yneQ [Bacillus subtilis subsp. subtilis str. 168] Length = 99 Score = 128 bits (321), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 58/99 (58%), Positives = 69/99 (69%) Query: 15 MAFGINREELTRWKQAVTAGEIAFLTHYWLDPRFPGMTTVTKVGCSNLSRLRSWCEQHGL 74 MAFG+ REEL RWKQAV GEIAFLTHYWLD RFP TVTK GC+++ +L W +GL Sbjct: 1 MAFGVKREELNRWKQAVKRGEIAFLTHYWLDDRFPEAKTVTKAGCADIDKLVQWGAAYGL 60 Query: 75 PSQYIHNRRPFPHFDLMGPKQPEILRQEGQWEQLERFHL 113 ++IH + FPHFDL+G Q IL QE + L RFHL Sbjct: 61 KKEWIHKKSEFPHFDLLGETQKYILEQENLTDHLIRFHL 99 >ref|NP_692606.1| hypothetical protein OB1685 [Oceanobacillus iheyensis HTE831] dbj|BAC13641.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 101 Score = 126 bits (316), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 54/99 (54%), Positives = 73/99 (73%) Query: 15 MAFGINREELTRWKQAVTAGEIAFLTHYWLDPRFPGMTTVTKVGCSNLSRLRSWCEQHGL 74 MAFG+ +EEL WK+ V +G+I FLTHYWLD RFPG TVTKVGCS+L++L++W Q+GL Sbjct: 1 MAFGLKKEELQSWKENVRSGKIDFLTHYWLDDRFPGCNTVTKVGCSDLNKLKAWGRQYGL 60 Query: 75 PSQYIHNRRPFPHFDLMGPKQPEILRQEGQWEQLERFHL 113 +I +PH+DL G Q +IL++E QW Q++RF L Sbjct: 61 QDNWIDMNEEYPHYDLFGDYQIKILKEEEQWTQIQRFKL 99 >ref|NP_243152.1| BH2286~unknown conserved protein in B. subtilis [Bacillus halodurans] pir||F83935 hypothetical protein BH2286 [imported] - Bacillus halodurans (strain C-125) dbj|BAB06005.1| BH2286~unknown conserved protein in B. subtilis [Bacillus halodurans] Length = 105 Score = 122 bits (306), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 56/99 (56%), Positives = 71/99 (71%) Query: 15 MAFGINREELTRWKQAVTAGEIAFLTHYWLDPRFPGMTTVTKVGCSNLSRLRSWCEQHGL 74 MAFGINR +L WK+ + GEIAFLTHYWLD RFP TVTKV C +L +L W +Q+GL Sbjct: 1 MAFGINRRQLLEWKKKASRGEIAFLTHYWLDSRFPECHTVTKVACRDLKKLTCWGQQYGL 60 Query: 75 PSQYIHNRRPFPHFDLMGPKQPEILRQEGQWEQLERFHL 113 ++IH+R FPHFDL+G +Q +IL QEG + L +F L Sbjct: 61 KQEWIHHRVDFPHFDLLGKRQVDILLQEGLEDHLTKFSL 99 >ref|NP_470657.1| similar to B. subtilis YneQ protein [Listeria innocua] pir||AH1597 B. subtilis YneQ protein homolog lin1321 [imported] - Listeria innocua (strain Clip11262) emb|CAC96552.1| lin1321 [Listeria innocua] Length = 103 Score = 119 bits (297), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 1/100 (1%) Query: 15 MAFGINREELTRWKQAVTAGEIAFLTHYWLDPRFPGMTTVTKVGCSNLSRLRSWCEQHGL 74 MAFG+ R+E+ WK+ GEIA +THYWLD RFP TVTKV C +L +L+ W +Q+GL Sbjct: 1 MAFGVKRDEMELWKEKAARGEIAIITHYWLDDRFPDSKTVTKVACVDLKKLQEWGKQYGL 60 Query: 75 PSQYIHNRRP-FPHFDLMGPKQPEILRQEGQWEQLERFHL 113 +I NRR FPH+DL G Q +L++E +EQ+ERFHL Sbjct: 61 APDWIDNRRKNFPHYDLFGEMQLVVLKKEKAFEQIERFHL 100 >ref|NP_464807.1| similar to B. subtilis YneQ protein [Listeria monocytogenes EGD-e] pir||AB1235 B. subtilis YneQ protein homolog lmo1282 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAC99360.1| lmo1282 [Listeria monocytogenes] Length = 103 Score = 118 bits (295), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 1/100 (1%) Query: 15 MAFGINREELTRWKQAVTAGEIAFLTHYWLDPRFPGMTTVTKVGCSNLSRLRSWCEQHGL 74 MAFG+ R+E+ WK+ GEIA +THYWLD RFP TVTKV C +L +L+ W +Q+GL Sbjct: 1 MAFGVKRDEMELWKEKAARGEIAIITHYWLDDRFPESKTVTKVACVDLKKLQQWGKQYGL 60 Query: 75 PSQYIHNRRP-FPHFDLMGPKQPEILRQEGQWEQLERFHL 113 +I NRR FPH+DL G Q +L++E +EQ+ERFHL Sbjct: 61 APDWIDNRRKNFPHYDLFGEMQLVVLKKEKAFEQIERFHL 100 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.324 0.138 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 180,746,158 Number of extensions: 6547263 Number of successful extensions: 13142 Number of sequences better than 1.0e-05: 5 Number of HSP's gapped: 13140 Number of HSP's successfully gapped: 5 Length of query: 114 Length of database: 757,237,578 Length adjustment: 79 Effective length of query: 35 Effective length of database: 542,744,757 Effective search space: 18996066495 Effective search space used: 18996066495 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 120 (50.8 bits)