BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0159.0003.p (79 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_391641.1| ywzC [Bacillus subtilis] >gi|7475532|pir||H7007... 81 9e-15 ref|NP_653849.1| hypothetical protein predicted by GeneMark [Bac... 78 6e-14 ref|NP_835045.1| hypothetical Cytosolic Protein [Bacillus cereus... 78 7e-14 ref|NP_763919.1| conserved hypothetical protein [Staphylococcus ... 74 8e-13 ref|NP_244688.1| BH3821~unknown conserved protein in B. subtilis... 74 9e-13 >ref|NP_391641.1| ywzC [Bacillus subtilis] pir||H70070 hypothetical protein ywzC - Bacillus subtilis emb|CAB15788.1| ywzC [Bacillus subtilis subsp. subtilis str. 168] Length = 74 Score = 80.9 bits (198), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 31/65 (47%), Positives = 50/65 (76%) Query: 1 MANDIRICDECNHIKMKSILPKLRKMAPDAEIKTGCISYCGPCGKRPFVYINGRYVSGPT 60 MAN+ R+CD+C +K++LP+L+++ PDA+++ GC SYCGP K+ F ++N R +S PT Sbjct: 1 MANEFRVCDDCQATNIKTLLPRLKEVDPDAKVEVGCQSYCGPGRKKSFAFVNNRPLSAPT 60 Query: 61 EDEVL 65 EDE++ Sbjct: 61 EDELI 65 >ref|NP_653849.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_847782.1| conserved hypothetical protein [Bacillus anthracis str. Ames] ref|NP_981805.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAP29268.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAS44413.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 74 Score = 77.8 bits (190), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 33/70 (47%), Positives = 49/70 (70%) Query: 1 MANDIRICDECNHIKMKSILPKLRKMAPDAEIKTGCISYCGPCGKRPFVYINGRYVSGPT 60 M N+ R+CD+C +K+++PKL+K+ A I+ GC SYCGP K+ F ++N R V+ PT Sbjct: 1 MGNEFRVCDDCQATNVKTLIPKLKKVDSCATIEVGCQSYCGPGRKKSFAFVNNRPVAAPT 60 Query: 61 EDEVLAKAEA 70 EDE++ K EA Sbjct: 61 EDELIVKIEA 70 >ref|NP_835045.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579] gb|AAP12246.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579] Length = 74 Score = 77.8 bits (190), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 33/70 (47%), Positives = 49/70 (70%) Query: 1 MANDIRICDECNHIKMKSILPKLRKMAPDAEIKTGCISYCGPCGKRPFVYINGRYVSGPT 60 M N+ R+CD+C +K+++PKL+K+ A I+ GC SYCGP K+ F ++N R V+ PT Sbjct: 1 MGNEFRVCDDCQATNIKTLVPKLKKVDSCATIEVGCQSYCGPGRKKSFAFVNNRPVAAPT 60 Query: 61 EDEVLAKAEA 70 EDE++ K EA Sbjct: 61 EDELIVKIEA 70 >ref|NP_763919.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] gb|AAO03961.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] Length = 113 Score = 74.3 bits (181), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 32/75 (42%), Positives = 49/75 (65%) Query: 1 MANDIRICDECNHIKMKSILPKLRKMAPDAEIKTGCISYCGPCGKRPFVYINGRYVSGPT 60 M N ICDEC + +KS+ KL K+ P+AEI+ GC SYCGP ++ F ++N R ++ T Sbjct: 1 MKNKFLICDECQAVNLKSLKRKLEKLDPEAEIEIGCQSYCGPGRRKTFAFVNNRPLAALT 60 Query: 61 EDEVLAKAEAFVKRP 75 E+E++ K +K+P Sbjct: 61 EEELMEKVTKQLKKP 75 >ref|NP_244688.1| BH3821~unknown conserved protein in B. subtilis [Bacillus halodurans] pir||E84127 hypothetical protein BH3821 [imported] - Bacillus halodurans (strain C-125) dbj|BAB07540.1| BH3821~unknown conserved protein in B. subtilis [Bacillus halodurans] Length = 74 Score = 74.3 bits (181), Expect = 9e-13, Method: Compositional matrix adjust. Identities = 31/63 (49%), Positives = 44/63 (69%) Query: 1 MANDIRICDECNHIKMKSILPKLRKMAPDAEIKTGCISYCGPCGKRPFVYINGRYVSGPT 60 MAN+ RICDEC +K+++PKL+K+ P+A I C SYCGP K+ F ++N R V+ P Sbjct: 1 MANEFRICDECQATNIKTLIPKLKKLDPNATIDIRCQSYCGPGRKKSFTFVNNRPVAAPD 60 Query: 61 EDE 63 ED+ Sbjct: 61 EDQ 63 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.321 0.138 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 116,293,908 Number of extensions: 3880439 Number of successful extensions: 7773 Number of sequences better than 1.0e-05: 6 Number of HSP's gapped: 7774 Number of HSP's successfully gapped: 6 Length of query: 79 Length of database: 757,237,578 Length adjustment: 49 Effective length of query: 30 Effective length of database: 624,197,727 Effective search space: 18725931810 Effective search space used: 18725931810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)