BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0149.0002.p (60 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_764877.1| tRNA-guanine transglycosylase [Staphylococcus e... 91 9e-18 ref|NP_372163.1| tRNA-guanine transglycosylase [Staphylococcus a... 90 2e-17 ref|NP_242094.1| tRNA-guanine transglycosylase [Bacillus halodur... 88 7e-17 ref|NP_834123.1| Queuine tRNA-ribosyltransferase [Bacillus cereu... 86 2e-16 ref|NP_658445.1| TGT, Queuine tRNA-ribosyltransferase [Bacillus ... 86 2e-16 >ref|NP_764877.1| tRNA-guanine transglycosylase [Staphylococcus epidermidis ATCC 12228] sp|Q8CML7|TGT_STAEP Queuine tRNA-ribosyltransferase (tRNA-guanine transglycosylase) (Guanine insertion enzyme) gb|AAO04921.1| tRNA-guanine transglycosylase [Staphylococcus epidermidis ATCC 12228] Length = 379 Score = 90.9 bits (224), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 43/61 (70%), Positives = 53/61 (86%), Gaps = 1/61 (1%) Query: 1 LRHLIKADETFGLRLTTYHNLYFLLELMRKMREAIREDRLLDFRDEFFAQYGL-YDNLKG 59 +RHL+KA+ETFG+RLTT HNL+FLL+LM +R+AIREDRLLDF+DEFF QYGL +N K Sbjct: 319 IRHLVKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKDEFFEQYGLNVENPKN 378 Query: 60 F 60 F Sbjct: 379 F 379 >ref|NP_372163.1| tRNA-guanine transglycosylase [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374752.1| tRNA-guanine transglycosylase [Staphylococcus aureus subsp. aureus N315] ref|NP_646406.1| tRNA-guanine transglycosylase [Staphylococcus aureus subsp. aureus MW2] sp|Q99TL4|TGT_STAAM Queuine tRNA-ribosyltransferase (tRNA-guanine transglycosylase) (Guanine insertion enzyme) pir||F89946 tRNA-guanine transglycosylase tgt [imported] - Staphylococcus aureus (strain N315) dbj|BAB42731.1| tRNA-guanine transglycosylase [Staphylococcus aureus subsp. aureus N315] dbj|BAB57801.1| tRNA-guanine transglycosylase [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB95454.1| tRNA-guanine transglycosylase [Staphylococcus aureus subsp. aureus MW2] Length = 379 Score = 89.7 bits (221), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 43/61 (70%), Positives = 53/61 (86%), Gaps = 1/61 (1%) Query: 1 LRHLIKADETFGLRLTTYHNLYFLLELMRKMREAIREDRLLDFRDEFFAQYGL-YDNLKG 59 +RHLIKA+ETFG+RLTT HNL+FLL+LM +R+AIREDRLLDF++EFF QYGL +N K Sbjct: 319 IRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKN 378 Query: 60 F 60 F Sbjct: 379 F 379 >ref|NP_242094.1| tRNA-guanine transglycosylase [Bacillus halodurans] sp|Q9KDI5|TGT_BACHD Queuine tRNA-ribosyltransferase (tRNA-guanine transglycosylase) (Guanine insertion enzyme) pir||D83803 tRNA-guanine transglycosylase tgt [imported] - Bacillus halodurans (strain C-125) dbj|BAB04947.1| tRNA-guanine transglycosylase [Bacillus halodurans] Length = 379 Score = 87.8 bits (216), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 42/61 (68%), Positives = 50/61 (81%), Gaps = 1/61 (1%) Query: 1 LRHLIKADETFGLRLTTYHNLYFLLELMRKMREAIREDRLLDFRDEFFAQYGL-YDNLKG 59 +RHL+K DETFG RLTTYHNLYFLL+LM+ +R+AI +DRLLDFR+EFF QYG N K Sbjct: 319 IRHLVKCDETFGFRLTTYHNLYFLLKLMKDVRQAILDDRLLDFREEFFEQYGFNQPNAKN 378 Query: 60 F 60 F Sbjct: 379 F 379 >ref|NP_834123.1| Queuine tRNA-ribosyltransferase [Bacillus cereus ATCC 14579] gb|AAP11324.1| Queuine tRNA-ribosyltransferase [Bacillus cereus ATCC 14579] Length = 379 Score = 86.3 bits (212), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 41/61 (67%), Positives = 50/61 (81%), Gaps = 1/61 (1%) Query: 1 LRHLIKADETFGLRLTTYHNLYFLLELMRKMREAIREDRLLDFRDEFFAQYGLY-DNLKG 59 +RHL+K DETFG+RLT+YHNL+FLL LM ++R+AIREDRL DFR+EFF QYG N K Sbjct: 319 IRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKN 378 Query: 60 F 60 F Sbjct: 379 F 379 >ref|NP_658445.1| TGT, Queuine tRNA-ribosyltransferase [Bacillus anthracis A2012] ref|NP_846864.1| queuine tRNA-ribosyltransferase [Bacillus anthracis str. Ames] ref|NP_980795.1| queuine tRNA-ribosyltransferase [Bacillus cereus ATCC 10987] gb|AAP28350.1| queuine tRNA-ribosyltransferase [Bacillus anthracis str. Ames] gb|AAS43403.1| queuine tRNA-ribosyltransferase [Bacillus cereus ATCC 10987] Length = 379 Score = 86.3 bits (212), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 41/61 (67%), Positives = 50/61 (81%), Gaps = 1/61 (1%) Query: 1 LRHLIKADETFGLRLTTYHNLYFLLELMRKMREAIREDRLLDFRDEFFAQYGLY-DNLKG 59 +RHL+K DETFG+RLT+YHNL+FLL LM ++R+AIREDRL DFR+EFF QYG N K Sbjct: 319 IRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKN 378 Query: 60 F 60 F Sbjct: 379 F 379 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.333 0.150 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 86,045,544 Number of extensions: 2515412 Number of successful extensions: 7464 Number of sequences better than 1.0e-05: 43 Number of HSP's gapped: 7465 Number of HSP's successfully gapped: 43 Length of query: 60 Length of database: 757,237,578 Length adjustment: 32 Effective length of query: 28 Effective length of database: 670,354,410 Effective search space: 18769923480 Effective search space used: 18769923480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 120 (50.8 bits)