BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0147.0028.p (146 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_388303.1| alternate gene name: yzzA~similar to general st... 123 1e-27 ref|NP_694064.1| hypothetical protein OB3142 [Oceanobacillus ihe... 102 3e-21 ref|NP_765517.1| general stress protein 26 [Staphylococcus epide... 95 6e-19 ref|NP_692626.1| general stress protein [Oceanobacillus iheyensi... 92 5e-18 ref|NP_466270.1| similar to B. subtilis stress protein YdaG [Lis... 91 6e-18 >ref|NP_388303.1| alternate gene name: yzzA~similar to general stress protein [Bacillus subtilis] sp|P80238|GS26_BACSU General stress protein 26 (GSP26) pir||G69768 general stress protein homolog ydaG - Bacillus subtilis dbj|BAA19260.1| FUNCTION UNKNOWN. [Bacillus subtilis] emb|CAB12229.1| ydaG [Bacillus subtilis subsp. subtilis str. 168] Length = 140 Score = 123 bits (309), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 55/129 (42%), Positives = 86/129 (66%), Gaps = 2/129 (1%) Query: 1 MDNRELEQTIIKTLDDNKFGSFGTIEAGNKPKVRYMAVFHDGLQIYLATNRKTHKVEELR 60 M+ ++++Q ++ LD +K GS T++ G KP RYM FHDGL IY T+++THK EE+ Sbjct: 1 MNQQDIKQKVLDVLDHHKVGSLATVQKG-KPHSRYMTFFHDGLTIYTPTSKETHKAEEIE 59 Query: 61 NNPNAFLLLGYE-QGGGKDVLEIEATVAVTKNEGLRSQVWNTELEKWFKGPDDPDYVILE 119 NNPN +LLGY+ +G G +E+ + + L+ ++W+++LE+WF G DDP+ VILE Sbjct: 60 NNPNVHILLGYDCEGFGDAYVEVAGKAKINNSAELKDKIWSSKLERWFDGKDDPNLVILE 119 Query: 120 LQPTRIEYM 128 ++P I M Sbjct: 120 IEPEDIRLM 128 >ref|NP_694064.1| hypothetical protein OB3142 [Oceanobacillus iheyensis HTE831] dbj|BAC15098.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 140 Score = 102 bits (253), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 47/131 (35%), Positives = 83/131 (63%), Gaps = 2/131 (1%) Query: 1 MDNRELEQTIIKTLDDNKFGSFGTIEAGNKPKVRYMAVFHDGLQIYLATNRKTHKVEELR 60 M + + + + L ++ G+ T++ NKP RYM FH L +Y AT+++T KVEE+ Sbjct: 1 MSQESIRKKVDQILSESPIGTMATVK-NNKPHSRYMLYFHRELTLYTATDKETDKVEEIE 59 Query: 61 NNPNAFLLLGYE-QGGGKDVLEIEATVAVTKNEGLRSQVWNTELEKWFKGPDDPDYVILE 119 +NP +L+GYE +G G + +E + V++ + L+ ++WN +++K+F GP+D Y+IL+ Sbjct: 60 SNPWTHILIGYEGEGFGDEYVEYQGKVSIESSPELKEELWNDDMKKYFSGPEDDSYIILK 119 Query: 120 LQPTRIEYMGK 130 ++PT I M K Sbjct: 120 VEPTAIRIMNK 130 >ref|NP_765517.1| general stress protein 26 [Staphylococcus epidermidis ATCC 12228] gb|AAO05603.1| general stress protein 26 [Staphylococcus epidermidis ATCC 12228] Length = 154 Score = 94.7 bits (234), Expect = 6e-19, Method: Compositional matrix adjust. Identities = 45/132 (34%), Positives = 78/132 (59%), Gaps = 1/132 (0%) Query: 1 MDNRELEQTIIKTLDDNKFGSFGTIEAGNKPKVRYMAVFHDGLQIYLATNRKTHKVEELR 60 ++ +++ + I K L+ +K G T NKP RYM ++D L +Y TN + KVEE+ Sbjct: 15 LNKQQVTKAIEKVLNSSKIGVLSTAH-HNKPNSRYMVFYNDDLNLYTKTNVNSLKVEEIE 73 Query: 61 NNPNAFLLLGYEQGGGKDVLEIEATVAVTKNEGLRSQVWNTELEKWFKGPDDPDYVILEL 120 NNP+A +LLGY + +EI+AT+ V K++ + +W T+ + +F +DP+ +L++ Sbjct: 74 NNPDAHILLGYNETTNNSFVEIDATIEVVKDQKVIDWLWETQDKTFFNSKEDPELCVLKV 133 Query: 121 QPTRIEYMGKDQ 132 P I+ M D+ Sbjct: 134 IPRSIKLMNDDE 145 >ref|NP_692626.1| general stress protein [Oceanobacillus iheyensis HTE831] dbj|BAC13661.1| general stress protein [Oceanobacillus iheyensis HTE831] Length = 141 Score = 91.7 bits (226), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 43/132 (32%), Positives = 78/132 (59%), Gaps = 2/132 (1%) Query: 1 MDNRELEQTIIKTLDDNKFGSFGTIEAGNKPKVRYMAVFHDGLQIYLATNRKTHKVEELR 60 M ++ I + L++N G+ T++ P RYM FH+ + +Y TN++T K E++ Sbjct: 1 MSQENVKHQIEQILENNFVGTMATVKK-QMPHSRYMTFFHENVTLYTPTNKETDKAEDIE 59 Query: 61 NNPNAFLLLGYE-QGGGKDVLEIEATVAVTKNEGLRSQVWNTELEKWFKGPDDPDYVILE 119 NP ++LGY+ +G G +E E V+ ++ L++++WN ++ +F GP+DP+ ILE Sbjct: 60 ANPYTHIILGYDGEGFGDKYVEYEGKVSFNDSQELKNKLWNDRMKLYFDGPNDPNLTILE 119 Query: 120 LQPTRIEYMGKD 131 ++P I M K+ Sbjct: 120 IKPLHIRLMNKN 131 >ref|NP_466270.1| similar to B. subtilis stress protein YdaG [Listeria monocytogenes EGD-e] pir||AC1418 B. subtilis stress protein YdaG homolog lmo2748 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAD00961.1| lmo2748 [Listeria monocytogenes] Length = 139 Score = 91.3 bits (225), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 40/127 (31%), Positives = 75/127 (59%), Gaps = 2/127 (1%) Query: 5 ELEQTIIKTLDDNKFGSFGTIEAGNKPKVRYMAVFHDGLQIYLATNRKTHKVEELRNNPN 64 ELE I+ L+ ++ G +++ G+ P RYM HDGL +Y + ++ K +E+R NP+ Sbjct: 4 ELEDKILAILEQHQVGVLTSVQ-GDYPHARYMTFLHDGLTLYTPSGKELPKTDEVRRNPH 62 Query: 65 AFLLLGYEQGGGKDVLEIEATVAVTKNEGLRSQVWNTELEKWFKGPDDPDYVILELQPTR 124 +L+GYE G LEI ++ ++E ++ ++W ++WF+G D P +V++++ P + Sbjct: 63 VSVLIGYESPGSA-FLEINGLASLEEDESIKERIWENISKEWFRGEDSPSFVVIKIVPEQ 121 Query: 125 IEYMGKD 131 I + D Sbjct: 122 IRILNSD 128 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.314 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 244,380,355 Number of extensions: 10107373 Number of successful extensions: 14268 Number of sequences better than 1.0e-05: 10 Number of HSP's gapped: 14264 Number of HSP's successfully gapped: 10 Length of query: 146 Length of database: 757,237,578 Length adjustment: 106 Effective length of query: 40 Effective length of database: 469,437,084 Effective search space: 18777483360 Effective search space used: 18777483360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)