BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0147.0021.p (134 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_623994.1| predicted Transcriptional regulator [Thermoanae... 109 2e-23 ref|NP_661706.1| transcriptional regulator, ArsR family [Chlorob... 109 2e-23 ref|NP_830412.1| Cadmium efflux system accessory protein [Bacill... 108 4e-23 ref|ZP_00060322.1| COG0640: Predicted transcriptional regulators... 108 5e-23 ref|ZP_00096964.1| COG0640: Predicted transcriptional regulators... 107 1e-22 >ref|NP_623994.1| predicted Transcriptional regulator [Thermoanaerobacter tengcongensis] gb|AAM25598.1| predicted Transcriptional regulator [Thermoanaerobacter tengcongensis] Length = 121 Score = 109 bits (272), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 50/92 (54%), Positives = 69/92 (75%) Query: 40 LPDRGTTDKMAEMFKALGDPTRVRMIYALSQRELCVHDLSSILDMGQSAVSHQLRYLRNL 99 +P+ +AE+FK LGD TR++++YAL + E+CV D++++L M QSAVSHQLR LR Sbjct: 28 MPEETKLYDLAELFKVLGDTTRIKILYALFESEMCVCDIAALLGMSQSAVSHQLRILRQN 87 Query: 100 RIVKRRKEGKTVYYSLNDTHVEQIFLQTHEHI 131 ++VK RKEGK VYYSL D HV++IF Q +HI Sbjct: 88 KLVKFRKEGKVVYYSLADDHVKKIFEQGFDHI 119 >ref|NP_661706.1| transcriptional regulator, ArsR family [Chlorobium tepidum TLS] gb|AAM72048.1| transcriptional regulator, ArsR family [Chlorobium tepidum TLS] Length = 123 Score = 109 bits (272), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 53/111 (47%), Positives = 78/111 (70%), Gaps = 1/111 (0%) Query: 22 CDNTCNGSELEPESMALILPDRGTTDKMAEMFKALGDPTRVRMIYALSQRELCVHDLSSI 81 C TC+ ++ ES+ +PD ++A++FK LGD TRVR++ AL + ELCV DL+SI Sbjct: 12 CQQTCDHPDV-VESVRQAMPDENQQQELAQLFKVLGDHTRVRILNALYRSELCVCDLTSI 70 Query: 82 LDMGQSAVSHQLRYLRNLRIVKRRKEGKTVYYSLNDTHVEQIFLQTHEHIR 132 L M QSAVSHQLR LR+ RIV+ +K+GK V Y+L+D+H+ ++ EH++ Sbjct: 71 LAMNQSAVSHQLRVLRDARIVRSKKQGKNVLYALDDSHIAELIKIGFEHVQ 121 >ref|NP_830412.1| Cadmium efflux system accessory protein [Bacillus cereus ATCC 14579] gb|AAP07613.1| Cadmium efflux system accessory protein [Bacillus cereus ATCC 14579] Length = 125 Score = 108 bits (270), Expect = 4e-23, Method: Compositional matrix adjust. Identities = 55/115 (47%), Positives = 74/115 (64%), Gaps = 1/115 (0%) Query: 20 EECDNTCNGSELEPESMALILPDRGTTDKMAEMFKALGDPTRVRMIYALSQRELCVHDLS 79 E C T E+ E + +P + K+AE+FK LGD TR R+++AL + E+CV DL+ Sbjct: 11 ETCSQTIIHEEV-VEQVKQTIPTDESLSKVAELFKVLGDRTRTRILHALFEAEMCVCDLA 69 Query: 80 SILDMGQSAVSHQLRYLRNLRIVKRRKEGKTVYYSLNDTHVEQIFLQTHEHIRHE 134 +L M QS++SHQLR L+ ++VK RKEGK VYYSL D HV IF Q EH+ E Sbjct: 70 YLLGMTQSSISHQLRVLKQAKLVKNRKEGKVVYYSLADQHVIHIFEQAFEHVNEE 124 >ref|ZP_00060322.1| COG0640: Predicted transcriptional regulators [Clostridium thermocellum ATCC 27405] Length = 143 Score = 108 bits (269), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 47/83 (56%), Positives = 66/83 (79%) Query: 49 MAEMFKALGDPTRVRMIYALSQRELCVHDLSSILDMGQSAVSHQLRYLRNLRIVKRRKEG 108 +AE+FK GD TR++++YAL E+CV D++++++M QSAVSHQLR L+ R+VK RKEG Sbjct: 52 LAELFKVFGDTTRIKILYALFASEMCVCDIAALINMTQSAVSHQLRVLKQARLVKYRKEG 111 Query: 109 KTVYYSLNDTHVEQIFLQTHEHI 131 K VYYSL+D H++QIF Q + HI Sbjct: 112 KVVYYSLDDDHIKQIFDQGYMHI 134 >ref|ZP_00096964.1| COG0640: Predicted transcriptional regulators [Desulfitobacterium hafniense] Length = 129 Score = 107 bits (266), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 51/90 (56%), Positives = 71/90 (78%), Gaps = 2/90 (2%) Query: 42 DRGTTDKMAEMFKALGDPTRVRMIYALSQRELCVHDLSSILDMGQSAVSHQLRYLRNLRI 101 DR T K+A++FK LGDPTRVR++ AL++ E+CV DL+ +L + QSA SHQLR LR+ + Sbjct: 40 DRAT--KLADLFKTLGDPTRVRLMDALAKTEICVCDLAELLGLSQSATSHQLRVLRSSNL 97 Query: 102 VKRRKEGKTVYYSLNDTHVEQIFLQTHEHI 131 VK R+EGK VYYSL+D+HV++++ Q EHI Sbjct: 98 VKYRREGKMVYYSLHDSHVQELYRQGLEHI 127 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 187,837,812 Number of extensions: 6385274 Number of successful extensions: 16099 Number of sequences better than 1.0e-05: 232 Number of HSP's gapped: 16125 Number of HSP's successfully gapped: 232 Length of query: 134 Length of database: 757,237,578 Length adjustment: 96 Effective length of query: 38 Effective length of database: 496,588,074 Effective search space: 18870346812 Effective search space used: 18870346812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)