BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0147.0015.p (172 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_243199.1| BH2333~unknown conserved protein in B. subtilis... 119 4e-26 ref|NP_978296.1| ccdC protein [Bacillus cereus ATCC 10987] >gi|4... 116 2e-25 ref|NP_657568.1| hypothetical protein predicted by GeneMark [Bac... 114 8e-25 ref|NP_833389.1| CcdC protein [Bacillus cereus ATCC 14579] >gi|2... 114 9e-25 ref|ZP_00183769.1| hypothetical protein Exigu076401 [Exiguobacte... 112 3e-24 >ref|NP_243199.1| BH2333~unknown conserved protein in B. subtilis [Bacillus halodurans] pir||E83941 hypothetical protein BH2333 [imported] - Bacillus halodurans (strain C-125) dbj|BAB06052.1| BH2333~unknown conserved protein in B. subtilis [Bacillus halodurans] Length = 169 Score = 119 bits (297), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 67/144 (46%), Positives = 90/144 (62%), Gaps = 1/144 (0%) Query: 13 STLGAVFMALMVIFIRLKASARPVTIRKIWIPPLGMSTGFAMFVVPEVRFPWWWAVAAFL 72 ST+GA+FMA MV+ IRLKAS RP T++KI +PP MSTGF MFV P R W + A Sbjct: 9 STIGAIFMATMVLIIRLKASKRPATVKKIILPPFFMSTGFFMFVYPPFRPSSWQVLEALC 68 Query: 73 VGWFIFAYPLMRSTKFEAREGLIYARRSKSFAFIXXXXXXIRTVLHEFINQYVSIPQSGG 132 VG IF+ L++++KFE R IY +RSK+F FI +R I + + G Sbjct: 69 VG-MIFSLFLIKTSKFEIRGDHIYLKRSKAFVFILIGLLILRIAFKLIIGDSIQFEELAG 127 Query: 133 LFFILAFGMILHWRVFMYKRYIRM 156 +FF+LA+GMI+ WRV MY Y ++ Sbjct: 128 MFFLLAYGMIIPWRVAMYVSYKKL 151 >ref|NP_978296.1| ccdC protein [Bacillus cereus ATCC 10987] gb|AAS40904.1| ccdC protein [Bacillus cereus ATCC 10987] Length = 159 Score = 116 bits (290), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 60/144 (41%), Positives = 92/144 (63%), Gaps = 1/144 (0%) Query: 13 STLGAVFMALMVIFIRLKASARPVTIRKIWIPPLGMSTGFAMFVVPEVRFPWWWAVAAFL 72 S++ AV MA+ V+F+R KA+ +PVT +KI +PP+ MSTG M+ +PE R V A Sbjct: 6 SSIVAVCMAVGVMFLRFKAAKKPVTKKKIILPPIFMSTGAMMYFLPEFRLTSLEIVEAIT 65 Query: 73 VGWFIFAYPLMRSTKFEAREGLIYARRSKSFAFIXXXXXXIRTVLHEFINQYVSIPQSGG 132 VG IF+ L+++TKFE R IY + SK+F FI +R L +++Q + + + G Sbjct: 66 VG-LIFSIFLIKTTKFEIRSEQIYMKPSKAFIFILVGLLAVRVALKSYLSQSIDLAELSG 124 Query: 133 LFFILAFGMILHWRVFMYKRYIRM 156 +FF+LAF MI+ WR+ MY+ + R+ Sbjct: 125 MFFLLAFAMIVSWRIAMYRSFTRL 148 >ref|NP_657568.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_845989.1| ccdC protein [Bacillus anthracis str. Ames] ref|NP_979991.1| ccdC protein [Bacillus cereus ATCC 10987] gb|AAP27475.1| ccdC protein [Bacillus anthracis str. Ames] gb|AAS42599.1| ccdC protein [Bacillus cereus ATCC 10987] Length = 168 Score = 114 bits (286), Expect = 8e-25, Method: Compositional matrix adjust. Identities = 61/146 (41%), Positives = 93/146 (63%), Gaps = 1/146 (0%) Query: 11 VGSTLGAVFMALMVIFIRLKASARPVTIRKIWIPPLGMSTGFAMFVVPEVRFPWWWAVAA 70 V S++ AV MA+ +FIRLKA+ +P T++KI +PP MSTG M+V PE R + A Sbjct: 5 VLSSIVAVCMAVGAMFIRLKAAKKPATLKKIILPPFFMSTGALMYVFPEFRLTPAEMLEA 64 Query: 71 FLVGWFIFAYPLMRSTKFEAREGLIYARRSKSFAFIXXXXXXIRTVLHEFINQYVSIPQS 130 VG F F+ L++++KFE R IY +RSK+F FI +R V +++Q + + Q Sbjct: 65 IGVGLF-FSIFLIKTSKFEIRGQEIYLKRSKAFVFILIGLLVVRIVFKTYLSQSLDLGQL 123 Query: 131 GGLFFILAFGMILHWRVFMYKRYIRM 156 G+FF+LAF MI+ WR+ MY+ + ++ Sbjct: 124 SGMFFLLAFAMIVSWRIAMYRSFTKL 149 >ref|NP_833389.1| CcdC protein [Bacillus cereus ATCC 14579] gb|AAP10590.1| CcdC protein [Bacillus cereus ATCC 14579] Length = 168 Score = 114 bits (285), Expect = 9e-25, Method: Compositional matrix adjust. Identities = 60/144 (41%), Positives = 92/144 (63%), Gaps = 1/144 (0%) Query: 13 STLGAVFMALMVIFIRLKASARPVTIRKIWIPPLGMSTGFAMFVVPEVRFPWWWAVAAFL 72 S++ AV MA+ +FIRLKA+ +P T++KI +PP MSTG M+V PE R + A Sbjct: 7 SSIVAVCMAVGAMFIRLKAAKKPATLKKIILPPFFMSTGALMYVFPEFRLTPAEMLEAIG 66 Query: 73 VGWFIFAYPLMRSTKFEAREGLIYARRSKSFAFIXXXXXXIRTVLHEFINQYVSIPQSGG 132 VG F F+ L++++KFE R IY +RSK+F FI +R V +++Q + + Q G Sbjct: 67 VGLF-FSIFLIKTSKFEIRGQEIYLKRSKAFVFILIGLLVVRIVFKTYLSQSLDLGQLSG 125 Query: 133 LFFILAFGMILHWRVFMYKRYIRM 156 +FF+LAF MI+ WR+ MY+ + ++ Sbjct: 126 MFFLLAFAMIVSWRIAMYRSFTKL 149 >ref|ZP_00183769.1| hypothetical protein Exigu076401 [Exiguobacterium sp. 255-15] Length = 160 Score = 112 bits (281), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 63/156 (40%), Positives = 92/156 (58%), Gaps = 4/156 (2%) Query: 13 STLGAVFMALMVIFIRLKASARPVTIRKIWIPPLGMSTGFAMFVVPEVRFPWWWAVAAFL 72 ST A+ M L++ FIR+KASA+P +KI IPP MSTG F+ P R W A L Sbjct: 5 STGVALVMGLLISFIRVKASAKPTNAKKILIPPFAMSTGMLQFLYPASRLTWTEVAEALL 64 Query: 73 VGWFIFAYPLMRSTKFEAREGLIYARRSKSFAFIXXXXXXIRTVLHEFINQYVSIPQSGG 132 VG IF+ L++++ F EG IY +RSK+F + +RTV I + I ++GG Sbjct: 65 VGA-IFSIFLIKTSNFYEAEGQIYLQRSKAFFIVLFGILIVRTVAKFVIGGQIDIFETGG 123 Query: 133 LFFILAFGMILHWRVFMYKRYIRM---VPPHAHTPE 165 +F+++AFGMI WR+ MY +Y ++ + P H P+ Sbjct: 124 IFYLVAFGMIAPWRIAMYLKYKQVKSGIVPVKHLPQ 159 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.333 0.144 0.478 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 239,618,591 Number of extensions: 8528384 Number of successful extensions: 39268 Number of sequences better than 1.0e-05: 13 Number of HSP's gapped: 39255 Number of HSP's successfully gapped: 13 Length of query: 172 Length of database: 757,237,578 Length adjustment: 117 Effective length of query: 55 Effective length of database: 439,570,995 Effective search space: 24176404725 Effective search space used: 24176404725 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 121 (51.2 bits)