BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0135.0006.p (127 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_346207.1| transcriptional regulator, putative [Streptococ... 83 2e-15 ref|NP_359192.1| Conserverd hypothetical protein [Streptococcus ... 83 2e-15 ref|NP_628100.1| putative transcriptional regulator [Streptomyce... 69 5e-11 ref|NP_825458.1| putative MarR-family transcriptional regulator ... 64 1e-09 ref|NP_631204.1| putative transcriptional regulator [Streptomyce... 59 3e-08 >ref|NP_346207.1| transcriptional regulator, putative [Streptococcus pneumoniae TIGR4] pir||F95206 transcription regulator, probable [imported] - Streptococcus pneumoniae (strain TIGR4) gb|AAK75847.1| transcriptional regulator, putative [Streptococcus pneumoniae TIGR4] Length = 153 Score = 82.8 bits (203), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 49/103 (47%), Positives = 60/103 (58%), Gaps = 6/103 (5%) Query: 6 ELEAKLQETFG------WSLNEFYLMYFLSEAPEKKLRLQQLESMVGLSQSAVSRLVSRF 59 E+E+ L+ET +L EFYL+Y+L A EK LR L + LS SAVSR+V+R Sbjct: 43 EIESLLEETIAQQSEQSLTLKEFYLLYYLDLAEEKSLRQIDLPDKLHLSPSAVSRMVARL 102 Query: 60 EAKGCGALQRTTCDDDRRSIYTSLTPIGQEKLDRAQVTVNEVL 102 EAK CG L R C DRRS + LT GQ+ L Q TV E L Sbjct: 103 EAKNCGLLSRMCCHQDRRSSFICLTNDGQKTLASLQKTVEESL 145 >ref|NP_359192.1| Conserverd hypothetical protein [Streptococcus pneumoniae R6] pir||F98071 conserverd hypothetical protein [imported] - Streptococcus pneumoniae (strain R6) gb|AAL00403.1| Conserverd hypothetical protein [Streptococcus pneumoniae R6] Length = 141 Score = 82.8 bits (203), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 49/103 (47%), Positives = 60/103 (58%), Gaps = 6/103 (5%) Query: 6 ELEAKLQETFG------WSLNEFYLMYFLSEAPEKKLRLQQLESMVGLSQSAVSRLVSRF 59 E+E+ L+ET +L EFYL+Y+L A EK LR L + LS SAVSR+V+R Sbjct: 31 EIESLLEETIAQQSEQSLTLKEFYLLYYLDLAEEKSLRQIDLPDKLHLSPSAVSRMVARL 90 Query: 60 EAKGCGALQRTTCDDDRRSIYTSLTPIGQEKLDRAQVTVNEVL 102 EAK CG L R C DRRS + LT GQ+ L Q TV E L Sbjct: 91 EAKNCGLLSRMCCHQDRRSSFICLTNDGQKTLASLQKTVEESL 133 >ref|NP_628100.1| putative transcriptional regulator [Streptomyces coelicolor A3(2)] pir||T36601 probable transcription regulator - Streptomyces coelicolor emb|CAB42742.1| putative transcriptional regulator [Streptomyces coelicolor A3(2)] Length = 154 Score = 68.6 bits (166), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 43/122 (35%), Positives = 65/122 (53%), Gaps = 5/122 (4%) Query: 2 KVAGELEAKLQETFGWSLNEFYLMYFLS---EAPEKKLRLQQLESMVGLSQSAVSRLVSR 58 ++ +E LQ S+ E+ L+ LS + L+++Q+ V LSQSA +RLV+R Sbjct: 24 RIEAHIERALQTGHDLSVREYSLLDVLSRQHDGDGGHLQMKQVADAVVLSQSATTRLVTR 83 Query: 59 FEAKGCGALQRTTCDDDRRSIYTSLTPIGQEKLDRAQVTVNEVLFEAFPRTEVKELLEDM 118 E +G L+R C DRR IYT++TP G + LD A+ T + L EA L + Sbjct: 84 LEDRGL--LERYLCPTDRRGIYTNVTPAGLQLLDEARPTNDTALREALDDAAANPDLAPL 141 Query: 119 LR 120 +R Sbjct: 142 VR 143 >ref|NP_825458.1| putative MarR-family transcriptional regulator [Streptomyces avermitilis MA-4680] dbj|BAC71993.1| putative MarR-family transcriptional regulator [Streptomyces avermitilis MA-4680] Length = 152 Score = 63.9 bits (154), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 5/108 (4%) Query: 2 KVAGELEAKLQETFGWSLNEFYLMYFLS---EAPEKKLRLQQLESMVGLSQSAVSRLVSR 58 ++ G +E LQ G S+ E+ L+ LS + L+++Q+ V LSQSA +RLV+R Sbjct: 24 RIEGHIERALQAKHGLSVREYSLLDVLSRQHDGEGGHLQMKQVADAVVLSQSATTRLVTR 83 Query: 59 FEAKGCGALQRTTCDDDRRSIYTSLTPIGQEKLDRAQVTVNEVLFEAF 106 E +G L R C DRR IYT+++ G + L+ A+ T + L +A Sbjct: 84 LEDRGL--LSRYLCPTDRRGIYTNVSEAGLKLLEEARPTNDAALRQAL 129 >ref|NP_631204.1| putative transcriptional regulator [Streptomyces coelicolor A3(2)] emb|CAC01634.1| putative transcriptional regulator [Streptomyces coelicolor A3(2)] Length = 160 Score = 59.3 bits (142), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 39/122 (31%), Positives = 62/122 (50%), Gaps = 5/122 (4%) Query: 2 KVAGELEAKLQETFGWSLNEFYLMYFLSE---APEKKLRLQQLESMVGLSQSAVSRLVSR 58 ++ +E L G ++EFY + L+E A L L L + GLSQSA SRLV+R Sbjct: 20 RIEARMERHLHRQLGLGVSEFYALRTLNEGVAAGTGLLYLSDLANGTGLSQSATSRLVTR 79 Query: 59 FEAKGCGALQRTTCDDDRRSIYTSLTPIGQEKLDRAQVTVNEVLFEAFPRTEVKELLEDM 118 + +G + + DDRRSI LT + + L +++ + E + V+E +D+ Sbjct: 80 LQERGL--ITTHSASDDRRSIEIELTAVAHDVLRLGSPLLSQAVEEVVRQLHVEETDKDL 137 Query: 119 LR 120 LR Sbjct: 138 LR 139 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.132 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 157,631,418 Number of extensions: 4924553 Number of successful extensions: 15135 Number of sequences better than 1.0e-05: 8 Number of HSP's gapped: 15165 Number of HSP's successfully gapped: 8 Length of query: 127 Length of database: 757,237,578 Length adjustment: 90 Effective length of query: 37 Effective length of database: 512,878,668 Effective search space: 18976510716 Effective search space used: 18976510716 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)