BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0117.0005.p (155 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_832717.1| Tetracycline resistance determinant tetV [Bacil... 69 3e-11 ref|NP_979328.1| permease, putative [Bacillus cereus ATCC 10987]... 69 4e-11 ref|NP_845321.1| permease, putative [Bacillus anthracis str. Ame... 68 7e-11 ref|NP_656855.1| hypothetical protein predicted by GeneMark [Bac... 68 7e-11 gb|EAI38878.1| unknown [environmental sequence] 56 2e-07 >ref|NP_832717.1| Tetracycline resistance determinant tetV [Bacillus cereus ATCC 14579] gb|AAP09918.1| Tetracycline resistance determinant tetV [Bacillus cereus ATCC 14579] Length = 404 Score = 68.9 bits (167), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 40/129 (31%), Positives = 63/129 (48%) Query: 3 KRSYYGLLSTISLSAFGDAFGLLAMEWLVYELTGSKLAMGALALSSGIPELVLRLIGSPL 62 RS++ + ++S G AFG L LVYELTGS++A+ ++ L IP L+L+LI P Sbjct: 7 NRSFFFMWIGSAISELGGAFGTLCNSILVYELTGSEMALSSMWLLYFIPSLILQLISGPF 66 Query: 63 SDRLPRVRFMACLAAVRLLAIALPLGMGLAGQLQLWHXXXXXXXXXXXXXXXMPTAMAVI 122 D+ R M +R LPL M ++G +++WH P + A+ Sbjct: 67 IDKWSRKWIMIFSQWIRASVFLLPLVMLVSGSIEVWHIYVVQIVVGLITPLYTPASQAIT 126 Query: 123 PGVADSRKL 131 P + +L Sbjct: 127 PSIVRKEQL 135 >ref|NP_979328.1| permease, putative [Bacillus cereus ATCC 10987] gb|AAS41936.1| permease, putative [Bacillus cereus ATCC 10987] Length = 406 Score = 68.9 bits (167), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 40/129 (31%), Positives = 61/129 (47%) Query: 3 KRSYYGLLSTISLSAFGDAFGLLAMEWLVYELTGSKLAMGALALSSGIPELVLRLIGSPL 62 RS++ + ++S G AFG L LVYELTGSK A+ ++ L IP L+L+LI P Sbjct: 9 NRSFFFMWIGSAISELGGAFGTLCNSILVYELTGSKTALSSMWLLYFIPSLILQLISGPF 68 Query: 63 SDRLPRVRFMACLAAVRLLAIALPLGMGLAGQLQLWHXXXXXXXXXXXXXXXMPTAMAVI 122 D+ R M +R PL M ++G +++WH P + A+ Sbjct: 69 IDKWSRKWIMIFSQWIRASVFLFPLVMLVSGSIEVWHIYVVQIVVGLITPLYTPASQAIT 128 Query: 123 PGVADSRKL 131 P + +L Sbjct: 129 PSIVGKEQL 137 >ref|NP_845321.1| permease, putative [Bacillus anthracis str. Ames] gb|AAP26807.1| permease, putative [Bacillus anthracis str. Ames] Length = 406 Score = 68.2 bits (165), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 40/129 (31%), Positives = 62/129 (48%) Query: 3 KRSYYGLLSTISLSAFGDAFGLLAMEWLVYELTGSKLAMGALALSSGIPELVLRLIGSPL 62 RS++ + ++S G FG L LVYELTGS++A+ ++ L IP L+L+LI P Sbjct: 9 NRSFFFMWIGSAISELGGGFGTLCNSILVYELTGSEMALSSMWLLYFIPSLILQLISGPF 68 Query: 63 SDRLPRVRFMACLAAVRLLAIALPLGMGLAGQLQLWHXXXXXXXXXXXXXXXMPTAMAVI 122 D+ R M +R LPL M ++G L++WH P + A+ Sbjct: 69 IDKWSRKWIMIFSQWIRASVFLLPLIMLVSGSLEVWHIYVVQIVVGLITPLYTPASQAIT 128 Query: 123 PGVADSRKL 131 P + +L Sbjct: 129 PSIVRKEQL 137 >ref|NP_656855.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] Length = 404 Score = 67.8 bits (164), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 40/129 (31%), Positives = 62/129 (48%) Query: 3 KRSYYGLLSTISLSAFGDAFGLLAMEWLVYELTGSKLAMGALALSSGIPELVLRLIGSPL 62 RS++ + ++S G FG L LVYELTGS++A+ ++ L IP L+L+LI P Sbjct: 7 NRSFFFMWIGSAISELGGGFGTLCNSILVYELTGSEMALSSMWLLYFIPSLILQLISGPF 66 Query: 63 SDRLPRVRFMACLAAVRLLAIALPLGMGLAGQLQLWHXXXXXXXXXXXXXXXMPTAMAVI 122 D+ R M +R LPL M ++G L++WH P + A+ Sbjct: 67 IDKWSRKWIMIFSXWIRASVFLLPLIMLVSGSLEVWHIYVVQIVVGLITPLYTPASQAIT 126 Query: 123 PGVADSRKL 131 P + +L Sbjct: 127 PSIVRKEQL 135 >gb|EAI38878.1| unknown [environmental sequence] Length = 409 Score = 56.2 bits (134), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 57/120 (47%), Gaps = 2/120 (1%) Query: 11 STISLSAFGDAFGLLAMEWLVYELTGSKLAMGALALSSGIPELVLRLIGSPLSDRLPRVR 70 + +SL FG F L+A+ W+V E TGS+ A+G + S+ P LVL L + DR+ R Sbjct: 17 NVMSLIGFG--FNLIAVSWMVLEKTGSEYALGKIMASATAPGLVLALFAGVIIDRVNRKW 74 Query: 71 FMACLAAVRLLAIALPLGMGLAGQLQLWHXXXXXXXXXXXXXXXMPTAMAVIPGVADSRK 130 + L R++ + L + L + QLW PTA A + + + ++ Sbjct: 75 LLVNLDIFRMIVVVSFLAVLLQNEFQLWFLYPVVVLMGLGNSLFWPTAQAFVQEIVEEKE 134 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.327 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 168,532,139 Number of extensions: 5948792 Number of successful extensions: 15574 Number of sequences better than 1.0e-05: 14 Number of HSP's gapped: 15593 Number of HSP's successfully gapped: 14 Length of query: 155 Length of database: 757,237,578 Length adjustment: 113 Effective length of query: 42 Effective length of database: 450,431,391 Effective search space: 18918118422 Effective search space used: 18918118422 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 120 (50.8 bits)