BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0109.0023.p (119 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_391096.1| similar to hypothetical proteins [Bacillus subt... 129 2e-29 ref|NP_371464.1| conserved hypothetical protein [Staphylococcus ... 114 9e-25 ref|NP_645639.1| conserved hypothetical protein [Staphylococcus ... 113 1e-24 ref|NP_653402.1| HesB-like, HesB-like domain [Bacillus anthracis... 113 2e-24 ref|NP_981366.1| hesB/yadR/yfhF family protein [Bacillus cereus ... 112 2e-24 >ref|NP_391096.1| similar to hypothetical proteins [Bacillus subtilis] sp|O32113|YUTM_BACSU Hypothetical protein yutM pir||G70024 conserved hypothetical protein yutM - Bacillus subtilis emb|CAB15206.1| yutM [Bacillus subtilis subsp. subtilis str. 168] Length = 120 Score = 129 bits (325), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 60/113 (53%), Positives = 81/113 (71%) Query: 2 ITISEAAAGQLKTMLAEQEIPNMFLRLGVTEGGCSGFSYAMGFDDNETDQDVYMDVQGMK 61 +TI+EAAA +K M+ E E N FLR+GV GGCSG SY MGF+ +++ D D G+ Sbjct: 5 VTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKSESDSVFDQHGIT 64 Query: 62 VVVSKDDIRYLNGLEIDFEESGMTGGFTINNPNATATCGCGSSFRTKDDAGKP 114 V+V K+ + +NG ID+++S + GGFTI+NPNA A+CGCGSSFRT +AGKP Sbjct: 65 VLVDKESLDIMNGTVIDYKQSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKP 117 >ref|NP_371464.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374062.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] pir||E89860 conserved hypothetical protein SA0801 [imported] - Staphylococcus aureus (strain N315) dbj|BAB42040.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] dbj|BAB57102.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] Length = 119 Score = 114 bits (284), Expect = 9e-25, Method: Compositional matrix adjust. Identities = 54/113 (47%), Positives = 78/113 (69%) Query: 2 ITISEAAAGQLKTMLAEQEIPNMFLRLGVTEGGCSGFSYAMGFDDNETDQDVYMDVQGMK 61 + ++EAAA ++K ML E+P+ +L++ V GGC+G +Y MG ++ + D ++ G+K Sbjct: 4 VILTEAAAYEVKDMLKANEMPDGYLKIKVNGGGCTGLTYGMGAEEAPGENDEVLEYFGLK 63 Query: 62 VVVSKDDIRYLNGLEIDFEESGMTGGFTINNPNATATCGCGSSFRTKDDAGKP 114 V+V K+D LNG IDF++S M GGF I+NPNA A+CGCGSSFRT AG P Sbjct: 64 VLVDKEDAPVLNGTTIDFKQSLMGGGFQIDNPNAIASCGCGSSFRTAKVAGNP 116 >ref|NP_645639.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] dbj|BAB94687.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] Length = 119 Score = 113 bits (282), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 54/113 (47%), Positives = 77/113 (68%) Query: 2 ITISEAAAGQLKTMLAEQEIPNMFLRLGVTEGGCSGFSYAMGFDDNETDQDVYMDVQGMK 61 + ++EAAA ++K ML E+P+ +L++ V GGC+G +Y MG ++ + D ++ G+K Sbjct: 4 VILTEAAAYEVKDMLKANEMPDGYLKIKVNGGGCTGLTYGMGAEEAPGENDEVLEYFGLK 63 Query: 62 VVVSKDDIRYLNGLEIDFEESGMTGGFTINNPNATATCGCGSSFRTKDDAGKP 114 V+V K D LNG IDF++S M GGF I+NPNA A+CGCGSSFRT AG P Sbjct: 64 VLVDKKDAPVLNGTTIDFKQSLMGGGFQIDNPNAIASCGCGSSFRTAKVAGNP 116 >ref|NP_653402.1| HesB-like, HesB-like domain [Bacillus anthracis A2012] ref|NP_834607.1| HESB protein [Bacillus cereus ATCC 14579] ref|NP_847353.1| hesB/yadR/yfhF family protein [Bacillus anthracis str. Ames] gb|AAP11808.1| HESB protein [Bacillus cereus ATCC 14579] gb|AAP28839.1| hesB/yadR/yfhF family protein [Bacillus anthracis str. Ames] Length = 117 Score = 113 bits (282), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 53/114 (46%), Positives = 78/114 (68%) Query: 1 MITISEAAAGQLKTMLAEQEIPNMFLRLGVTEGGCSGFSYAMGFDDNETDQDVYMDVQGM 60 MI ++E AA Q+K ML + E ++RL V GGCSG SY +GF+ + D ++ G+ Sbjct: 1 MIEVTEQAAFQIKDMLKDAEDGEKYVRLAVHGGGCSGLSYGLGFEVEPKEDDTVLEFFGV 60 Query: 61 KVVVSKDDIRYLNGLEIDFEESGMTGGFTINNPNATATCGCGSSFRTKDDAGKP 114 + V+ K+ + G++ID+++S + GGFTI+NPNA A+CGCGSSFRT +AGKP Sbjct: 61 EFVIDKESAPIVKGVKIDYKQSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKP 114 >ref|NP_981366.1| hesB/yadR/yfhF family protein [Bacillus cereus ATCC 10987] gb|AAS43974.1| hesB/yadR/yfhF family protein [Bacillus cereus ATCC 10987] Length = 130 Score = 112 bits (281), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 53/114 (46%), Positives = 78/114 (68%) Query: 1 MITISEAAAGQLKTMLAEQEIPNMFLRLGVTEGGCSGFSYAMGFDDNETDQDVYMDVQGM 60 MI ++E AA Q+K ML + E ++RL V GGCSG SY +GF+ + D ++ G+ Sbjct: 14 MIEVTEQAAFQIKDMLKDAEDGEKYVRLAVHGGGCSGLSYGLGFEVEPNEDDTVLEFFGV 73 Query: 61 KVVVSKDDIRYLNGLEIDFEESGMTGGFTINNPNATATCGCGSSFRTKDDAGKP 114 + V+ K+ + G++ID+++S + GGFTI+NPNA A+CGCGSSFRT +AGKP Sbjct: 74 EFVIDKESAPIVKGVKIDYKQSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKP 127 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.316 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 181,193,231 Number of extensions: 7294736 Number of successful extensions: 17594 Number of sequences better than 1.0e-05: 825 Number of HSP's gapped: 17414 Number of HSP's successfully gapped: 825 Length of query: 119 Length of database: 757,237,578 Length adjustment: 84 Effective length of query: 35 Effective length of database: 529,169,262 Effective search space: 18520924170 Effective search space used: 18520924170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)