BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0109.0011.p (114 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_658723.1| thiored, Thioredoxin [Bacillus anthracis A2012]... 95 4e-19 ref|ZP_00046715.1| COG0526: Thiol-disulfide isomerase and thiore... 94 9e-19 ref|NP_981129.1| thioredoxin family protein [Bacillus cereus ATC... 94 1e-18 ref|NP_965472.1| thioredoxin [Lactobacillus johnsonii NCC 533] >... 94 1e-18 ref|NP_390862.1| similar to thioredoxin H1 [Bacillus subtilis] >... 93 2e-18 >ref|NP_658723.1| thiored, Thioredoxin [Bacillus anthracis A2012] ref|NP_834397.1| Thioredoxin [Bacillus cereus ATCC 14579] ref|NP_847142.1| thioredoxin family protein [Bacillus anthracis str. Ames] gb|AAP11598.1| Thioredoxin [Bacillus cereus ATCC 14579] gb|AAP28628.1| thioredoxin family protein [Bacillus anthracis str. Ames] Length = 104 Score = 95.1 bits (235), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 46/103 (44%), Positives = 70/103 (67%), Gaps = 2/103 (1%) Query: 1 MDKITSPAEFQVAIQSPRLTVAVFKADWCSDCKFIDPFMPDVEQKYTDRLTLVEVDVDAV 60 M + S +FQ +++ V +F A+WC DC+F+DPFMP+VE+KY+D + VD D Sbjct: 1 MKSLESMEQFQ-QLKNEENVVFMFSAEWCPDCRFVDPFMPEVEEKYSD-FSFYYVDRDEF 58 Query: 61 GDVSQEQNILGIPSFVAYSDGRELVRFVNKLRKSREEIEGFLD 103 D+ + ++ GIPSFVAY+ G E R+VNK RK++E+IE F++ Sbjct: 59 IDLCVKLDVFGIPSFVAYNKGEETGRYVNKDRKTQEQIEEFIE 101 >ref|ZP_00046715.1| COG0526: Thiol-disulfide isomerase and thioredoxins [Lactobacillus gasseri] Length = 109 Score = 94.0 bits (232), Expect = 9e-19, Method: Compositional matrix adjust. Identities = 42/83 (50%), Positives = 59/83 (71%), Gaps = 1/83 (1%) Query: 21 VAVFKADWCSDCKFIDPFMPDVEQKYTDRLTLVEVDVDAVGDVSQEQNILGIPSFVAYSD 80 V +F A WC DC+F+DPF+P +E+ +D ++D D DV++E NI GIPSFV Y D Sbjct: 25 VLLFLATWCPDCRFLDPFLPQIEKDNSD-AKFYKIDRDGSIDVAKELNIFGIPSFVVYQD 83 Query: 81 GRELVRFVNKLRKSREEIEGFLD 103 G+E+ R VNK RK++EE+E FL+ Sbjct: 84 GKEIGRLVNKDRKTKEEVENFLN 106 >ref|NP_981129.1| thioredoxin family protein [Bacillus cereus ATCC 10987] gb|AAS43737.1| thioredoxin family protein [Bacillus cereus ATCC 10987] Length = 104 Score = 94.0 bits (232), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 45/103 (43%), Positives = 69/103 (66%), Gaps = 2/103 (1%) Query: 1 MDKITSPAEFQVAIQSPRLTVAVFKADWCSDCKFIDPFMPDVEQKYTDRLTLVEVDVDAV 60 M + S +FQ +++ + +F A+WC DC+F+DPFMP+VE+KY+D + VD D Sbjct: 1 MKSLESMEQFQ-ELKNEENVIFMFSAEWCPDCRFVDPFMPEVEEKYSD-FSFYYVDRDEF 58 Query: 61 GDVSQEQNILGIPSFVAYSDGRELVRFVNKLRKSREEIEGFLD 103 D+ + ++ GIPSFVAY+ G E R+VNK RK++E IE F++ Sbjct: 59 IDLCVKLDVFGIPSFVAYNKGEETGRYVNKDRKTQEXIEEFIE 101 >ref|NP_965472.1| thioredoxin [Lactobacillus johnsonii NCC 533] gb|AAS09438.1| thioredoxin [Lactobacillus johnsonii NCC 533] Length = 106 Score = 93.6 bits (231), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 42/83 (50%), Positives = 58/83 (69%), Gaps = 1/83 (1%) Query: 21 VAVFKADWCSDCKFIDPFMPDVEQKYTDRLTLVEVDVDAVGDVSQEQNILGIPSFVAYSD 80 V +F A WC DC+F+DPF+P +E+ D ++D D DV++E NI GIPSFV Y D Sbjct: 22 VLLFSATWCPDCRFLDPFLPQIEKDNPD-AKFYKIDRDGSIDVAKELNIFGIPSFVVYQD 80 Query: 81 GRELVRFVNKLRKSREEIEGFLD 103 G+E+ R VNK RK++EE+E FL+ Sbjct: 81 GKEIGRLVNKDRKTKEEVENFLN 103 >ref|NP_390862.1| similar to thioredoxin H1 [Bacillus subtilis] pir||G69998 thioredoxin H1 homolog ytpP - Bacillus subtilis gb|AAC00289.1| putative thioredoxin [Bacillus subtilis] emb|CAB14962.1| ytpP [Bacillus subtilis subsp. subtilis str. 168] Length = 107 Score = 93.2 bits (230), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 47/106 (44%), Positives = 69/106 (65%), Gaps = 2/106 (1%) Query: 1 MDKITSPAEFQVAIQSPRLTVAVFKADWCSDCKFIDPFMPDVEQKYTDRLTLVEVDVDAV 60 M KI S E + A++ +V +F ADWC DC+F++PF+P++E + + T VD D Sbjct: 1 MKKIESTQELEKAVKD-DWSVFMFSADWCPDCRFVEPFLPELEANFPE-FTYYYVDRDKF 58 Query: 61 GDVSQEQNILGIPSFVAYSDGRELVRFVNKLRKSREEIEGFLDRAL 106 D E I GIPSFV +++G+E+ RFV+K RK++EEIE FL +L Sbjct: 59 IDTCAEWEIYGIPSFVVFNEGKEVNRFVSKDRKTKEEIEQFLTDSL 104 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.322 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 153,701,627 Number of extensions: 5516333 Number of successful extensions: 16496 Number of sequences better than 1.0e-05: 286 Number of HSP's gapped: 16647 Number of HSP's successfully gapped: 286 Length of query: 114 Length of database: 757,237,578 Length adjustment: 79 Effective length of query: 35 Effective length of database: 542,744,757 Effective search space: 18996066495 Effective search space used: 18996066495 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)