BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0109.0001.p (118 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00097603.1| COG1658: Small primase-like proteins (Toprim ... 87 9e-17 ref|NP_391157.1| yusF [Bacillus subtilis] >gi|7475455|pir||G7002... 75 7e-13 ref|NP_371359.1| conserved hypothetical protein [Staphylococcus ... 72 3e-12 ref|NP_981421.1| Toprim domain protein [Bacillus cereus ATCC 109... 71 8e-12 ref|NP_834661.1| DNA primase (bacterial type) and small primase-... 70 1e-11 >ref|ZP_00097603.1| COG1658: Small primase-like proteins (Toprim domain) [Desulfitobacterium hafniense] Length = 115 Score = 87.4 bits (215), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 47/111 (42%), Positives = 65/111 (58%) Query: 1 MSITIIVEGKNDRSRLRRILAPEVDIQCTFGTLNTLKLETLRRKIGDGEVYLYMDNDSSG 60 M+ IIVEGK D+ RL+ +LA V+I C++GT++ K E ++ D EVYL +D D SG Sbjct: 1 MAKVIIVEGKTDKERLQEVLAEPVEILCSYGTISYEKTEEWATQLEDSEVYLLVDADDSG 60 Query: 61 KKIRGILRDAFPDAVHIYTRKGYAGVEGTPDEYSITQLEKAGLEEFIIYPE 111 +KIR L A P+ H+YT + Y V TP + L+ A E I PE Sbjct: 61 EKIRKSLNQALPNIHHLYTHRMYREVATTPLDVLAQVLDHAHFEVKEIRPE 111 >ref|NP_391157.1| yusF [Bacillus subtilis] pir||G70020 hypothetical protein yusF - Bacillus subtilis emb|CAB15267.1| yusF [Bacillus subtilis subsp. subtilis str. 168] Length = 146 Score = 74.7 bits (182), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 37/108 (34%), Positives = 63/108 (58%) Query: 4 TIIVEGKNDRSRLRRILAPEVDIQCTFGTLNTLKLETLRRKIGDGEVYLYMDNDSSGKKI 63 +IVEGK+D+ ++ +L + I CT GT++ L+LE L ++ D +VY+ +D D SG+K+ Sbjct: 33 VMIVEGKSDKEKIESVLNEPMRIICTNGTISQLRLEELADELYDKDVYILVDADESGEKL 92 Query: 64 RGILRDAFPDAVHIYTRKGYAGVEGTPDEYSITQLEKAGLEEFIIYPE 111 R L+ F +A H++ + Y V P + + L +A L I+ E Sbjct: 93 RKQLKREFNEACHLHVDRAYKEVAAAPRHHIASVLLRANLNVHTIFLE 140 >ref|NP_371359.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374028.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] ref|NP_645605.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] pir||C89856 conserved hypothetical protein SA0768 [imported] - Staphylococcus aureus (strain N315) dbj|BAB42006.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] dbj|BAB56997.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB94653.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] Length = 128 Score = 72.4 bits (176), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 34/100 (34%), Positives = 57/100 (57%) Query: 4 TIIVEGKNDRSRLRRILAPEVDIQCTFGTLNTLKLETLRRKIGDGEVYLYMDNDSSGKKI 63 IIVEGK+D+ R+++++A V+I CT GT++ KL+ + + D +V++ D+D G +I Sbjct: 7 VIIVEGKSDKKRVQQVIAEPVNIICTHGTMSIDKLDDMIESLYDKQVFVLADSDDEGDRI 66 Query: 64 RGILRDAFPDAVHIYTRKGYAGVEGTPDEYSITQLEKAGL 103 R + ++ HI+ K Y V P +Y L K G Sbjct: 67 RNWFKRYLSESEHIFIDKTYCQVANCPKQYLAHVLSKHGF 106 >ref|NP_981421.1| Toprim domain protein [Bacillus cereus ATCC 10987] gb|AAS44029.1| Toprim domain protein [Bacillus cereus ATCC 10987] Length = 114 Score = 70.9 bits (172), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 38/106 (35%), Positives = 57/106 (53%) Query: 4 TIIVEGKNDRSRLRRILAPEVDIQCTFGTLNTLKLETLRRKIGDGEVYLYMDNDSSGKKI 63 IIVEG +DR ++ I+ V+I CT GT+ K++ L + D EVY+ +D D +G+K+ Sbjct: 7 VIIVEGTSDRRKIESIIREPVEIVCTNGTIGLSKMDELVDQFFDKEVYVLVDADDAGEKL 66 Query: 64 RGILRDAFPDAVHIYTRKGYAGVEGTPDEYSITQLEKAGLEEFIIY 109 R R FP A HIY + Y V P + L A ++ + Y Sbjct: 67 RKQFRKEFPQAEHIYIDRSYREVATAPSSHLANVLWGADIDVYTEY 112 >ref|NP_834661.1| DNA primase (bacterial type) and small primase-like proteins [Bacillus cereus ATCC 14579] gb|AAP11862.1| DNA primase (bacterial type) and small primase-like proteins [Bacillus cereus ATCC 14579] Length = 114 Score = 70.5 bits (171), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 38/106 (35%), Positives = 57/106 (53%) Query: 4 TIIVEGKNDRSRLRRILAPEVDIQCTFGTLNTLKLETLRRKIGDGEVYLYMDNDSSGKKI 63 IIVEG +DR ++ I+ V+I CT GT+ K++ L + D EVY+ +D D +G+K+ Sbjct: 7 VIIVEGTSDRRKIESIIREPVEIVCTNGTIGLSKMDELVDQFFDKEVYVLVDADDAGEKL 66 Query: 64 RGILRDAFPDAVHIYTRKGYAGVEGTPDEYSITQLEKAGLEEFIIY 109 R R FP A HIY + Y V P + L A ++ + Y Sbjct: 67 RKQFRKEFPQAEHIYIDRSYREVATAPSTHLANVLWGADIDVYTEY 112 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.141 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 185,285,931 Number of extensions: 7492842 Number of successful extensions: 15664 Number of sequences better than 1.0e-05: 9 Number of HSP's gapped: 15674 Number of HSP's successfully gapped: 9 Length of query: 118 Length of database: 757,237,578 Length adjustment: 83 Effective length of query: 35 Effective length of database: 531,884,361 Effective search space: 18615952635 Effective search space used: 18615952635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)