BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0103.0009.p
         (123 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF 
           2,715,099 sequences; 757,237,578 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_657656.1| hypothetical protein predicted by GeneMark [Bac...    64   1e-09

>ref|NP_657656.1| hypothetical protein predicted by GeneMark [Bacillus anthracis
           A2012]
 ref|NP_846080.1| conserved hypothetical protein [Bacillus anthracis str. Ames]
 gb|AAP27566.1| conserved hypothetical protein [Bacillus anthracis phage lambda
           Ba04]
          Length = 66

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 44/57 (77%)

Query: 60  YSEFGAEARKVMLQKKIKMKDVASELGVSVTYVSEIFKGTRPGERQKPLIAKMLGME 116
           YS FG E RKV+L++ + +  +ASEL +SV+Y+S+I KG+R G++QK  I ++LG++
Sbjct: 3   YSSFGIEVRKVLLERDLTLTVLASELKISVSYLSDILKGSRKGKKQKKAIVELLGLD 59


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 24, 2004  1:53 AM
  Number of letters in database: 757,237,578
  Number of sequences in database:  2,715,099
  
Lambda     K      H
   0.319    0.134    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 2715099
Number of Hits to DB: 158,943,667
Number of extensions: 5339133
Number of successful extensions: 16974
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 16975
Number of HSP's successfully gapped: 1
Length of query: 123
Length of database: 757,237,578
Length adjustment: 87
Effective length of query: 36
Effective length of database: 521,023,965
Effective search space: 18756862740
Effective search space used: 18756862740
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 120 (50.8 bits)