BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0100.0018.p (191 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_693254.1| hypothetical protein OB2333 [Oceanobacillus ihe... 97 1e-19 ref|NP_655286.1| hypothetical protein predicted by GeneMark [Bac... 90 2e-17 ref|NP_831166.1| Thioredoxin [Bacillus cereus ATCC 14579] >gi|29... 90 2e-17 ref|NP_977825.1| conserved hypothetical protein [Bacillus cereus... 90 2e-17 gb|EAD88798.1| unknown [environmental sequence] 79 7e-14 >ref|NP_693254.1| hypothetical protein OB2333 [Oceanobacillus iheyensis HTE831] dbj|BAC14289.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 178 Score = 97.4 bits (241), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 49/182 (26%), Positives = 99/182 (54%), Gaps = 11/182 (6%) Query: 9 FGQGLTPRQFVEGMTKNQQAFESWYEKFAWEDQDDRAYFESLNHRDDLRVLILAADWCGD 68 + +G++ ++E M ++++ Y+ F D+ SL R LR++++ DWCGD Sbjct: 7 YNKGMSVDDYIESMQVHKESLLHIYDHFQLPDK------LSLVDRS-LRIIVITEDWCGD 59 Query: 69 VVRNVPVVFRILETAGIKTEVLILEENQDVMDDFLTMG-GRSVPIVIFADTGGYVLGHWG 127 + N+P++ R+ E + + +L+ ++N ++MD +LT G RS+PI IF D G + WG Sbjct: 60 AMLNIPILLRMAEESNMPVRILLRDDNLELMDQYLTNGKSRSIPIFIFIDEDGEEVATWG 119 Query: 128 PRXXXPEHVQSLMREFKRENPDREAPDYESKIAEVRKAMGQAYGEGTESHAVIAKELRSL 187 PR E +Q + + + P +EA D+E K E+ + ++Y + + + +++ Sbjct: 120 PRA---EKIQEYVDNAREQLPSKEASDFEEKQKEMFLFLTKSYRDNQDMWNTVYNSIKNT 176 Query: 188 IS 189 ++ Sbjct: 177 LA 178 >ref|NP_655286.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_843861.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP25347.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 184 Score = 90.1 bits (222), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 57/160 (35%), Positives = 81/160 (50%), Gaps = 6/160 (3%) Query: 4 NVAHKFGQGLTPRQFVEGMTKNQQAFESWYEKFAWEDQDDRAYFESLNHRDDLRVLILAA 63 N+ +G++ +V M NQ Y F ++ E N D RV++L A Sbjct: 2 NLQQWADKGMSFDTYVNEMKVNQYELLHIYNNFLIPNELLPVLEERQN--DGWRVIVLTA 59 Query: 64 DWCGDVVRNVPVVFRILETAGIKTEVLILEENQDVMDDFLTMG-GRSVPIVIFADTGGYV 122 DWCGD + VPV+ RI E A I +LI +EN ++MD +LT G R++PI IF D G Sbjct: 60 DWCGDALLCVPVMKRISEVANIDMSLLIRDENLELMDQYLTNGTARAIPIFIFIDKDGNE 119 Query: 123 LGHWGPRXXXPEHVQSLMREFKRENPDREAPDYESKIAEV 162 WGPR VQ L+ + P++E P +E K E+ Sbjct: 120 QAVWGPRA---PKVQELVTSMRATLPEKEDPTFEEKQKEM 156 >ref|NP_831166.1| Thioredoxin [Bacillus cereus ATCC 14579] gb|AAP08367.1| Thioredoxin [Bacillus cereus ATCC 14579] Length = 184 Score = 90.1 bits (222), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 57/160 (35%), Positives = 81/160 (50%), Gaps = 6/160 (3%) Query: 4 NVAHKFGQGLTPRQFVEGMTKNQQAFESWYEKFAWEDQDDRAYFESLNHRDDLRVLILAA 63 N+ +G++ +V M NQ Y F ++ E N D RV++L A Sbjct: 2 NLQQWADKGMSFDTYVNEMQVNQYELLHIYNNFLIPNELLPVLEERQN--DGWRVIVLTA 59 Query: 64 DWCGDVVRNVPVVFRILETAGIKTEVLILEENQDVMDDFLTMG-GRSVPIVIFADTGGYV 122 DWCGD + VPV+ RI E A I +LI +EN ++MD +LT G R++PI IF D G Sbjct: 60 DWCGDALLCVPVMKRISEVANIDMSLLIRDENLELMDQYLTNGTARAIPIFIFIDKDGNE 119 Query: 123 LGHWGPRXXXPEHVQSLMREFKRENPDREAPDYESKIAEV 162 WGPR VQ L+ + P++E P +E K E+ Sbjct: 120 QAVWGPRA---PKVQELVTSMRATLPEKEDPTFEEKQKEM 156 >ref|NP_977825.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS40433.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 184 Score = 90.1 bits (222), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 56/153 (36%), Positives = 79/153 (51%), Gaps = 6/153 (3%) Query: 11 QGLTPRQFVEGMTKNQQAFESWYEKFAWEDQDDRAYFESLNHRDDLRVLILAADWCGDVV 70 +G++ +V M NQ Y F ++ E N D RV++L ADWCGD + Sbjct: 9 KGMSFDTYVNEMKVNQYELLHIYNNFLIPNELLPVLEERQN--DGWRVIVLTADWCGDAL 66 Query: 71 RNVPVVFRILETAGIKTEVLILEENQDVMDDFLTMG-GRSVPIVIFADTGGYVLGHWGPR 129 VPV+ RI E A I +LI +EN ++MD +LT G R++PI IF D G WGPR Sbjct: 67 LCVPVMKRISEVANIDMSLLIRDENLELMDQYLTNGTARAIPIFIFIDKDGNEQAVWGPR 126 Query: 130 XXXPEHVQSLMREFKRENPDREAPDYESKIAEV 162 VQ L+ + P++E P +E K E+ Sbjct: 127 A---PKVQELVTSMRATLPEKEDPTFEEKQKEM 156 >gb|EAD88798.1| unknown [environmental sequence] Length = 130 Score = 78.6 bits (192), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 36/92 (39%), Positives = 61/92 (66%), Gaps = 5/92 (5%) Query: 56 LRVLILAADWCGDVVRNVPVVFRILET-AGIKTEVLILEENQDVMDDFLTMGGRSVP-IV 113 ++ ++L WCGD +N+P++ +I E I+ +++ +E+ ++MD FLT GGRS+P ++ Sbjct: 1 MQFVLLTEGWCGDAAQNLPLINKIAEAHTQIELSLILRDEHLEIMDQFLTNGGRSIPKLI 60 Query: 114 IFADTGGYVLGHWGPRXXXPEHVQSLMREFKR 145 + G VLG WGPR PE Q+++REFK+ Sbjct: 61 AIKQSSGEVLGTWGPR---PEVAQNMVREFKK 89 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.319 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 288,857,583 Number of extensions: 11585316 Number of successful extensions: 26146 Number of sequences better than 1.0e-05: 7 Number of HSP's gapped: 26141 Number of HSP's successfully gapped: 7 Length of query: 191 Length of database: 757,237,578 Length adjustment: 119 Effective length of query: 72 Effective length of database: 434,140,797 Effective search space: 31258137384 Effective search space used: 31258137384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 122 (51.6 bits)