BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0100.0013.p
         (66 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF 
           2,715,099 sequences; 757,237,578 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_391746.1| yxlE [Bacillus subtilis] >gi|7475557|pir||H7008...    65   4e-10

>ref|NP_391746.1| yxlE [Bacillus subtilis]
 pir||H70081 hypothetical protein yxlE - Bacillus subtilis
 dbj|BAA11736.1| hypothetical [Bacillus subtilis]
 emb|CAB15893.1| yxlE [Bacillus subtilis subsp. subtilis str. 168]
          Length = 62

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 41/61 (67%)

Query: 6  EIKWGLIWPLLALQVLLAVIGLVSLGKAEQTRGPKWLWVIILIFGNLLGSVAYFTVGRKD 65
           I W +I PL+ LQ+ LAV  L+S  K E+T GPKW+W  I++  N++G + +FTVGRK 
Sbjct: 2  NISWEMILPLIVLQLALAVFALISCIKEERTNGPKWMWAAIIVCINIIGPILFFTVGRKQ 61

Query: 66 N 66
           
Sbjct: 62 R 62


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 24, 2004  1:53 AM
  Number of letters in database: 757,237,578
  Number of sequences in database:  2,715,099
  
Lambda     K      H
   0.326    0.144    0.464 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 2715099
Number of Hits to DB: 96,437,753
Number of extensions: 2855138
Number of successful extensions: 11297
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 11301
Number of HSP's successfully gapped: 2
Length of query: 66
Length of database: 757,237,578
Length adjustment: 37
Effective length of query: 29
Effective length of database: 656,778,915
Effective search space: 19046588535
Effective search space used: 19046588535
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 120 (50.8 bits)