BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0100.0009.p (95 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P58250|GATC_BACST Glutamyl-tRNA(Gln) amidotransferase subunit... 110 1e-23 ref|ZP_00181732.1| hypothetical protein Mther028301 [Moorella th... 110 1e-23 gb|AAN87374.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [He... 107 8e-23 ref|NP_954423.1| glutamyl-tRNA(Gln) amidotransferase, C subunit ... 102 4e-21 ref|NP_654250.1| Glu-tRNAGln, Glu-tRNAGln amidotransferase C sub... 101 5e-21 >sp|P58250|GATC_BACST Glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT subunit C) gb|AAK72611.1| glutamyl-tRNAGln amidotransferase subunit C [Geobacillus stearothermophilus] Length = 96 Score = 110 bits (275), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 51/93 (54%), Positives = 72/93 (77%) Query: 3 ITVHDVQHVAKLARLHLSPEEEAKLTEQMNAILQYAEKLNELDTENVKPTTHVLQVSNVM 62 I++ V+HVA LARL ++ EE T+Q++AI+ +AE+LNELDTENV PT+HVL + NVM Sbjct: 4 ISIEQVKHVADLARLAITDEEAEMFTKQLDAIITFAEQLNELDTENVPPTSHVLDMRNVM 63 Query: 63 RDDVVKESLSQEEALLNAPEDEDGHFKVPAVLE 95 R+D+ + L +EE L NAP+ +DG F+VPA+LE Sbjct: 64 REDIPEPGLPREEVLKNAPDQQDGQFRVPAILE 96 >ref|ZP_00181732.1| hypothetical protein Mther028301 [Moorella thermoacetica ATCC 39073] Length = 94 Score = 110 bits (274), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 53/94 (56%), Positives = 68/94 (72%) Query: 1 MSITVHDVQHVAKLARLHLSPEEEAKLTEQMNAILQYAEKLNELDTENVKPTTHVLQVSN 60 M I+ +V+HVA LARL LSPEE+ TEQ+NAIL+Y +KLN LDT +V+PT HVL + N Sbjct: 1 MPISTAEVEHVALLARLKLSPEEKTAYTEQLNAILEYMDKLNALDTRDVEPTAHVLPLRN 60 Query: 61 VMRDDVVKESLSQEEALLNAPEDEDGHFKVPAVL 94 V RDD + L +E+AL APE +G FKVP V+ Sbjct: 61 VFRDDCARPGLPREKALQGAPEVSEGQFKVPRVV 94 >gb|AAN87374.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Heliobacillus mobilis] Length = 94 Score = 107 bits (267), Expect = 8e-23, Method: Compositional matrix adjust. Identities = 52/94 (55%), Positives = 68/94 (72%) Query: 1 MSITVHDVQHVAKLARLHLSPEEEAKLTEQMNAILQYAEKLNELDTENVKPTTHVLQVSN 60 MS+T +VQHVA LARL LS +E K T Q+N IL YA++L LDT NV PT HV + N Sbjct: 1 MSLTKDEVQHVAMLARLELSDKEVEKYTTQLNDILGYAQRLQALDTANVPPTAHVFPLQN 60 Query: 61 VMRDDVVKESLSQEEALLNAPEDEDGHFKVPAVL 94 VMRDD V S+++E+ L NAP++EDG F+VP ++ Sbjct: 61 VMRDDCVDPSMAREKILANAPDEEDGFFRVPKIV 94 >ref|NP_954423.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Geobacter sulfurreducens PCA] gb|AAR36773.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Geobacter sulfurreducens PCA] Length = 95 Score = 102 bits (253), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 49/95 (51%), Positives = 67/95 (70%) Query: 1 MSITVHDVQHVAKLARLHLSPEEEAKLTEQMNAILQYAEKLNELDTENVKPTTHVLQVSN 60 M IT DV+HVA LARL L+ +E+ + T Q++AIL Y EKLNELDT+ + PT+H + V N Sbjct: 1 MKITRTDVEHVATLARLELTEDEKDRFTGQLDAILAYVEKLNELDTDGIIPTSHAVPVEN 60 Query: 61 VMRDDVVKESLSQEEALLNAPEDEDGHFKVPAVLE 95 R+D V+ S+ E AL NAP+ +G F+VP V+E Sbjct: 61 AFREDEVRPSIGVENALANAPDRVEGFFRVPRVIE 95 >ref|NP_654250.1| Glu-tRNAGln, Glu-tRNAGln amidotransferase C subunit [Bacillus anthracis A2012] ref|NP_830189.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Bacillus cereus ATCC 14579] ref|NP_842867.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus anthracis str. Ames] ref|NP_976677.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus ATCC 10987] sp|Q81IN4|GATC_BACCR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) sp|Q81ZE9|GATC_BACAA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) gb|AAP07390.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Bacillus cereus ATCC 14579] gb|AAP24353.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus anthracis str. Ames] gb|AAS39285.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus ATCC 10987] Length = 96 Score = 101 bits (252), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 51/93 (54%), Positives = 71/93 (76%) Query: 3 ITVHDVQHVAKLARLHLSPEEEAKLTEQMNAILQYAEKLNELDTENVKPTTHVLQVSNVM 62 I+V +V+HVA LARL ++ +E K +Q++AI+ +AE+LNELDT +VKPTTHVL + NVM Sbjct: 4 ISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNELDTTDVKPTTHVLTMKNVM 63 Query: 63 RDDVVKESLSQEEALLNAPEDEDGHFKVPAVLE 95 R+DV ++ L EE L NAP+ +D +VPAVLE Sbjct: 64 REDVPEKGLPVEEVLKNAPDHKDNQIRVPAVLE 96 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.309 0.125 0.330 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 127,061,102 Number of extensions: 3997719 Number of successful extensions: 13804 Number of sequences better than 1.0e-05: 384 Number of HSP's gapped: 13791 Number of HSP's successfully gapped: 384 Length of query: 95 Length of database: 757,237,578 Length adjustment: 63 Effective length of query: 32 Effective length of database: 586,186,341 Effective search space: 18757962912 Effective search space used: 18757962912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 120 (50.8 bits)