BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0087.0011.p (122 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_471704.1| similar to AbiD phage protein [Listeria innocua... 68 6e-11 gb|EAC08202.1| unknown [environmental sequence] 64 1e-09 ref|ZP_00119712.1| COG4823: Abortive infection bacteriophage res... 61 9e-09 emb|CAD48017.1| hypothetical protein [Arthrobacter nicotinovorans] 59 4e-08 ref|NP_720525.1| conserved hypothetical protein [Streptococcus m... 54 8e-07 >ref|NP_471704.1| similar to AbiD phage protein [Listeria innocua] ref|NP_471892.1| similar to unknown protein [Listeria innocua] pir||AE1752 hypothetical protein homolog lin2562 [imported] - Listeria innocua (strain Clip11262) pir||AH1728 AbiD phage protein homolog lin2373 [imported] - Listeria innocua (strain Clip11262) emb|CAC97600.1| lin2373 [Listeria innocua] emb|CAC97789.1| lin2562 [Listeria innocua] Length = 298 Score = 68.2 bits (165), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 37/102 (36%), Positives = 62/102 (60%), Gaps = 3/102 (2%) Query: 20 GQFARFIASWLHAISNLRNICAHYGRIYNRNFPIAPKLFARDKKGIIDNNKVYAIVYNMK 79 G A +I SWLH + +RNICAH GR+YNR ++PKL K ++ +++ +++ K Sbjct: 189 GYDAEYIQSWLHTVVLIRNICAHNGRLYNRTITVSPKLPNGTAK--LNIKRIFIVIFIFK 246 Query: 80 YLISDKKYWNSWVERLRSLIDEYSEV-DLRLIGFHQNWYNLI 120 +L D+ W +V ++ LI +Y EV +L +IGF + W ++ Sbjct: 247 FLCVDQTEWEIFVNKIEELIQKYQEVIELEMIGFPETWKEML 288 >gb|EAC08202.1| unknown [environmental sequence] Length = 102 Score = 63.9 bits (154), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 33/97 (34%), Positives = 53/97 (54%), Gaps = 7/97 (7%) Query: 29 WLHAISNLRNICAHYGRIYNRNFPIAPKLFAR-------DKKGIIDNNKVYAIVYNMKYL 81 WL +I+ +RN+CAH+ R++N+N P KL ++ D D ++Y V MKYL Sbjct: 1 WLQSIAQIRNLCAHHARLWNKNLPGTVKLLSKAPNPWLNDIPKQHDFQRLYVHVCLMKYL 60 Query: 82 ISDKKYWNSWVERLRSLIDEYSEVDLRLIGFHQNWYN 118 ++ N+ E+L L+ Y +D R +G +NW N Sbjct: 61 LNIIHPANTLKEKLEDLLKRYPSIDPRALGLKENWQN 97 >ref|ZP_00119712.1| COG4823: Abortive infection bacteriophage resistance protein [Cytophaga hutchinsonii] Length = 331 Score = 60.8 bits (146), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 28/90 (31%), Positives = 51/90 (56%), Gaps = 5/90 (5%) Query: 27 ASWLHAISNLRNICAHYGRIYNRNFPIAPKLFARDKKGIID-----NNKVYAIVYNMKYL 81 SWLH ++ +RNICAH+ R++NR+ I P+ + G ID N +V+ + +KY+ Sbjct: 223 TSWLHTLTYIRNICAHHSRLWNRDLAIEPEKLLKPTGGWIDKPFENNKRVFYFLCVLKYM 282 Query: 82 ISDKKYWNSWVERLRSLIDEYSEVDLRLIG 111 + NS ++L+ L + Y + ++ +G Sbjct: 283 LQRANPGNSMKDKLQDLFNRYPNIPIKFLG 312 >emb|CAD48017.1| hypothetical protein [Arthrobacter nicotinovorans] Length = 479 Score = 58.5 bits (140), Expect = 4e-08, Method: Composition-based stats. Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (3%) Query: 18 AEGQFARFIASWLHAISNLRNICAHYGRIYNRNFPIAPK-LFARDKKGIIDN--NKVYAI 74 A G + +A W+ ++ +RN CAH+ R++N+N + K L A ++ +N N+VYA Sbjct: 222 AAGGNGKALAGWIANLNYIRNTCAHHARLWNKNMAVQGKELTAIEELRHAENSKNRVYAS 281 Query: 75 VYNMKYLISDKKYWNSWVERLRSLIDEY-SEVDLRLIGFHQNW 116 + M YL+ + W L IDE+ S VDL +GF +NW Sbjct: 282 LAVMAYLLLISNPDSHWRRDLLDFIDEHSSRVDLTKMGFPENW 324 >ref|NP_720525.1| conserved hypothetical protein [Streptococcus mutans UA159] gb|AAN57831.1| conserved hypothetical protein [Streptococcus mutans UA159] Length = 292 Score = 54.3 bits (129), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 33/99 (33%), Positives = 56/99 (56%), Gaps = 3/99 (3%) Query: 26 IASWLHAISNLRNICAHYGRIYNRNFPIAP-KLFARDKKGIIDNNKVYAIVYNMKYLISD 84 + ++L LRN CAHY R+Y R+F P +L + + N++ A +Y +K L +D Sbjct: 192 VRTYLEVAVVLRNYCAHYSRLYYRSFTKVPGQLPPFMTENVKIKNRLMAQLYAIKQLYTD 251 Query: 85 KKYW-NSWVERLRSLIDEY-SEVDLRLIGFHQNWYNLIK 121 + W N+++ RLR L +Y S + L +GF +W ++K Sbjct: 252 RDKWNNNFIPRLRGLFAKYQSSIHLHHLGFTGDWEYVLK 290 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.327 0.141 0.473 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 202,468,693 Number of extensions: 8038325 Number of successful extensions: 26040 Number of sequences better than 1.0e-05: 6 Number of HSP's gapped: 26038 Number of HSP's successfully gapped: 6 Length of query: 122 Length of database: 757,237,578 Length adjustment: 86 Effective length of query: 36 Effective length of database: 523,739,064 Effective search space: 18854606304 Effective search space used: 18854606304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 120 (50.8 bits)