BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0081.0014.p (143 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00099267.1| hypothetical protein [Desulfitobacterium hafn... 116 2e-25 ref|ZP_00061153.1| hypothetical protein [Clostridium thermocellu... 92 4e-18 ref|ZP_00046456.1| hypothetical protein [Lactobacillus gasseri] 77 9e-14 ref|NP_945299.1| hypothetical protein EJ-1p60 [Bacteriophage EJ-... 73 2e-12 ref|NP_390476.1| similar to phage-related protein [Bacillus subt... 70 2e-11 >ref|ZP_00099267.1| hypothetical protein [Desulfitobacterium hafniense] Length = 133 Score = 116 bits (290), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 54/114 (47%), Positives = 81/114 (71%) Query: 28 SLTYRMDWDKKRITSRLDGLEAVQQAVAKMLRTDRYEHLIYSSDYGTEWSLVLGKDRLLV 87 SLT+R+D K RIT RLDGLE+VQQA AK+L+T R+ HLIY+ +YG+E ++G +R V Sbjct: 20 SLTWRLDPAKGRITGRLDGLESVQQAAAKILQTQRFRHLIYTPNYGSELGQLIGMNRAFV 79 Query: 88 RAEIRRIVSEALLQDERIIGLEDTKVSFNGDNLSFSCKVITQYGNFELRKEMSE 141 ++E R++ EAL QD+RI G+E+ + + GD+L VI+ YG F + +E+ + Sbjct: 80 KSEAVRMLEEALTQDDRITGVENVQTTAAGDSLLIEFTVISTYGRFNMTQEVGD 133 >ref|ZP_00061153.1| hypothetical protein [Clostridium thermocellum ATCC 27405] Length = 131 Score = 91.7 bits (226), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 49/124 (39%), Positives = 80/124 (64%), Gaps = 4/124 (3%) Query: 18 DTSLGNTEM--SSLTYRMDWDKKRITSRLDGLEAVQQAVAKMLRTDRYEHLIYSSDYGTE 75 + LG+ E +S TY++ DK I +DGLEA++QA+ K+L T+RYE+ IYS +YG E Sbjct: 8 NIELGSAESIETSRTYKLSGDK--IQGYVDGLEALKQAIYKVLNTERYEYPIYSFNYGIE 65 Query: 76 WSLVLGKDRLLVRAEIRRIVSEALLQDERIIGLEDTKVSFNGDNLSFSCKVITQYGNFEL 135 ++GKD + V+ E++R + E LL+D+RI +++ K NGD + + V + +GNF Sbjct: 66 LESLIGKDPIYVQIELKRRIRECLLRDDRITDVDNFKFEVNGDEIKCTFDVHSIFGNFTA 125 Query: 136 RKEM 139 +E+ Sbjct: 126 SREV 129 >ref|ZP_00046456.1| hypothetical protein [Lactobacillus gasseri] Length = 140 Score = 77.4 bits (189), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 45/122 (36%), Positives = 70/122 (57%), Gaps = 1/122 (0%) Query: 20 SLGNTEMSSLTYRMDWDKKRITSRLDGLEAVQQAVAKMLRTDRYEHLIYSSDYGTEWSLV 79 +L N E + T RI ++ DGL A+ QAV K+L+T+R+ IY+ YG + + + Sbjct: 17 NLDNEENQNPTLTFQIANGRIRNKFDGLGAMVQAVDKILKTERFVFPIYTDQYGNDLNDL 76 Query: 80 LGKDRLLVRAEIRRIVSEALLQDERIIGLEDTKVSFNGDN-LSFSCKVITQYGNFELRKE 138 LGKD + E R+V EALL DER+I ++ T ++ N L+ + + T YGN + E Sbjct: 77 LGKDLGYSKVEAERMVKEALLADERVIKVDITSINETSPNTLTLTGECQTSYGNIPIESE 136 Query: 139 MS 140 +S Sbjct: 137 VS 138 >ref|NP_945299.1| hypothetical protein EJ-1p60 [Bacteriophage EJ-1] emb|CAE82142.1| hypothetical protein [Bacteriophage EJ-1] Length = 130 Score = 72.8 bits (177), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 45/116 (38%), Positives = 73/116 (62%), Gaps = 3/116 (2%) Query: 26 MSSLTYRMDWDKKRITSRLDGLEAVQQAVAKMLRTDRYEHLIYSSDYGTEWSLVLGKDRL 85 + S TY++ RI +DGLEA++QAV K+L T+R+E +IYSS+YG E ++GK Sbjct: 12 LPSYTYQVK--NGRIHGYIDGLEAMKQAVEKILLTERFEWVIYSSNYGVELERLIGKPYD 69 Query: 86 LVRAEIRRIVSEALLQDERIIGLEDTKV-SFNGDNLSFSCKVITQYGNFELRKEMS 140 V+A++ R +S+ALL D RI +++ + D+L +V T G F++ KE++ Sbjct: 70 FVKADLERTISQALLVDTRIKSVQNFFIEQQTKDSLLCVFEVHTISGLFKVEKEVT 125 >ref|NP_390476.1| similar to phage-related protein [Bacillus subtilis] sp|P45934|YQBS_BACSU Hypothetical protein yqbS pir||F69948 phage-related protein homolog yqbS - Bacillus subtilis dbj|BAA06951.1| ORF88 [Bacillus subtilis] dbj|BAA12415.1| YqbS [Bacillus subtilis] emb|CAB14540.1| yqbS [Bacillus subtilis subsp. subtilis str. 168] Length = 141 Score = 69.7 bits (169), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 42/121 (34%), Positives = 68/121 (56%), Gaps = 4/121 (3%) Query: 27 SSLTYRMDWDKKRITSRL-DGLEAVQQAVAKMLRTDRYEHLIYSSDYGTEWSLVLGKDRL 85 +S TY++D++ RIT+ + GLEA++Q V L T+RY + +YS D G E VL + Sbjct: 21 TSQTYKIDFENGRITNEIITGLEAIKQFVYLSLHTERYAYSVYSHDIGNELQDVLADNET 80 Query: 86 ---LVRAEIRRIVSEALLQDERIIGLEDTKVSFNGDNLSFSCKVITQYGNFELRKEMSEG 142 + EI R++ EAL+ D+RI + D ++ G++ S V T G E+ + + E Sbjct: 81 TDAYKKMEIPRLIEEALIYDDRISAVTDFEIEKQGESFRVSFTVETDEGTLEIEEVLGED 140 Query: 143 V 143 V Sbjct: 141 V 141 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 201,675,146 Number of extensions: 6952817 Number of successful extensions: 16523 Number of sequences better than 1.0e-05: 9 Number of HSP's gapped: 16516 Number of HSP's successfully gapped: 9 Length of query: 143 Length of database: 757,237,578 Length adjustment: 104 Effective length of query: 39 Effective length of database: 474,867,282 Effective search space: 18519823998 Effective search space used: 18519823998 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)