BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0081.0008.p (135 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00061149.1| hypothetical protein [Clostridium thermocellu... 94 1e-18 ref|NP_945294.1| hypothetical protein EJ-1p55 [Bacteriophage EJ-... 93 2e-18 ref|ZP_00046451.1| hypothetical protein [Lactobacillus gasseri] 71 7e-12 ref|ZP_00099272.1| COG2895: GTPases - Sulfate adenylate transfer... 70 2e-11 ref|NP_390481.1| similar to phage-related protein [Bacillus subt... 62 3e-09 >ref|ZP_00061149.1| hypothetical protein [Clostridium thermocellum ATCC 27405] Length = 185 Score = 94.0 bits (232), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 51/107 (47%), Positives = 73/107 (68%), Gaps = 4/107 (3%) Query: 16 VVSQRFKDKEGQPVAWKLRSMTEDENQECRKAATRKVKGKSGVYTSEIDPNDYMAKLMTS 75 +VS RFKDK+G V +++R +T++EN+ K T++ K K Y D +Y+++L S Sbjct: 21 IVSNRFKDKDGNLVPFEIRPITQEENKMLIKKYTKRDK-KGQEY---FDRAEYISELTAS 76 Query: 76 SVVHPDLKNAELQRSYNVLGAEALLRKMLLPGEFAALGERVQALNGF 122 +VV PDL NAELQ++Y VLGA ALL+KML GE+A L + VQ L+G Sbjct: 77 AVVFPDLTNAELQKAYGVLGASALLQKMLYVGEYAELAQAVQELSGL 123 >ref|NP_945294.1| hypothetical protein EJ-1p55 [Bacteriophage EJ-1] emb|CAE82137.1| hypothetical protein [Bacteriophage EJ-1] Length = 198 Score = 92.8 bits (229), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 57/134 (42%), Positives = 81/134 (60%), Gaps = 8/134 (5%) Query: 2 FFAQNVACDTTEEFVVSQRFKDKEGQPVAWKLRSMTEDENQECRKAATRKVKGKSGVYTS 61 F +NV + T+E V +RFK + +RS+ E N +K AT K K + GV Sbjct: 6 FLLENVQQEETKE-VHLKRFKS------PFVIRSIDESLNDTLKKRATIKKKNRQGVAIP 58 Query: 62 EIDPNDYMAKLMTSSVVHPDLKNAELQRSYNVLGAE-ALLRKMLLPGEFAALGERVQALN 120 E + + Y+ LM++ VV PDLK+A+LQ SY +G E A L+ ML GE+A L + +Q+LN Sbjct: 59 EFNNDKYIDSLMSACVVTPDLKDAQLQESYRTVGDEAATLKAMLKIGEYATLMQEIQSLN 118 Query: 121 GFATDMNELVEEVK 134 GF D+N+LVEE K Sbjct: 119 GFDEDINDLVEESK 132 >ref|ZP_00046451.1| hypothetical protein [Lactobacillus gasseri] Length = 139 Score = 71.2 bits (173), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 48/138 (34%), Positives = 73/138 (52%), Gaps = 10/138 (7%) Query: 2 FFAQNVACDTTEEFVVSQRFKDKEGQPVAWKLRSMTEDENQECRKAATRKV-KGKSGVYT 60 F +NV E+ V +RFK +K++S+T DE RK AT++V K+ Y Sbjct: 8 FLFENVGSPVEEKEVKLERFKS------PFKIKSLTADEVSHIRKQATKRVLNRKTHRYE 61 Query: 61 SEIDPNDYMAKLMTSSVVHPDLKNAELQRSYNVLG-AEALLRKMLLPGEFAALGERVQAL 119 E D N + ++ +VV P+L N +LQ S+ + E +L+KML GE+ L + + L Sbjct: 62 QETDENQFQGLVVAEAVVSPNLNNEKLQTSWGCIAKPEEVLKKMLKVGEYTELSQAIMDL 121 Query: 120 NGFATD--MNELVEEVKN 135 +G D +LVEE KN Sbjct: 122 SGLNDDDSSEDLVEEAKN 139 >ref|ZP_00099272.1| COG2895: GTPases - Sulfate adenylate transferase subunit 1 [Desulfitobacterium hafniense] Length = 137 Score = 69.7 bits (169), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 46/134 (34%), Positives = 68/134 (50%), Gaps = 4/134 (2%) Query: 5 QNVACDTTEEFVVSQRFKDKEGQPVAWKLRSMTEDENQECRKAATRKVKGKSGVYTSEID 64 Q+ D EE +R G+ K + ++ E R++ RK G E D Sbjct: 5 QDFLMDNFEEAEPIERRVSLGGKEKIMKFKPISAATGDEIRRSC-RKTTFHKGQRLVETD 63 Query: 65 PNDYMAKLMTSSVVHPDLKNAELQRSYNVLGAEALLRKM---LLPGEFAALGERVQALNG 121 + ++AKL+ + PD K+ ELQ+S+ VLGAE LL+ M + GE+A V +NG Sbjct: 64 QDAFVAKLIIETTTVPDFKSQELQQSWGVLGAENLLKAMKTKMKDGEYATFSNIVSEVNG 123 Query: 122 FATDMNELVEEVKN 135 + MN+LVEE KN Sbjct: 124 YDKSMNDLVEEAKN 137 >ref|NP_390481.1| similar to phage-related protein [Bacillus subtilis] sp|P45930|YQBN_BACSU Hypothetical protein yqbN pir||A69948 phage-related protein homolog yqbN - Bacillus subtilis dbj|BAA06946.1| ORF55 [Bacillus subtilis] dbj|BAA12410.1| YqbN [Bacillus subtilis] emb|CAB14545.1| yqbN [Bacillus subtilis subsp. subtilis str. 168] Length = 149 Score = 62.4 bits (150), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 43/138 (31%), Positives = 69/138 (50%), Gaps = 6/138 (4%) Query: 2 FFAQNVACDTTE-EFVVSQRFKDKEGQPVAWKLRSMTEDENQECRKAAT--RKVKGKSGV 58 FF D E E +S+RF DKEG V + +++T D E K T + VKG+ V Sbjct: 14 FFMPGQTIDAEEVEVPISKRFVDKEGNVVPFIFKAITTDRIDELEKENTTYKNVKGRGRV 73 Query: 59 YTSEIDPNDYMAKLMTSSVVHPDLKNAELQRSYNVLGAEALLRKML-LPGEFAALGERVQ 117 E+D + A++ + V+P K EL+ +Y + +++L + GE+A + Sbjct: 74 --KELDSQRFYARIAVETTVYPTFKAKELREAYKTEDPVEVAKRVLSVGGEYANWLNKAI 131 Query: 118 ALNGFATDMNELVEEVKN 135 +NGF D+ +L E KN Sbjct: 132 EINGFDDDLEDLEEAAKN 149 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.314 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 180,644,320 Number of extensions: 6208372 Number of successful extensions: 12620 Number of sequences better than 1.0e-05: 7 Number of HSP's gapped: 12612 Number of HSP's successfully gapped: 7 Length of query: 135 Length of database: 757,237,578 Length adjustment: 97 Effective length of query: 38 Effective length of database: 493,872,975 Effective search space: 18767173050 Effective search space used: 18767173050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 120 (50.8 bits)