BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0081.0002.p (149 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_244416.1| immunity repressor protein (phage-related prote... 101 4e-21 ref|NP_391246.1| similar to hypothetical proteins [Bacillus subt... 99 3e-20 ref|NP_391247.1| similar to hypothetical proteins [Bacillus subt... 87 1e-16 gb|AAB91591.1| Orf2 [Bacillus subtilis] 87 2e-16 ref|NP_695143.1| repressor [Bacteriophage phig1e] >gi|7450563|pi... 70 2e-11 >ref|NP_244416.1| immunity repressor protein (phage-related protein) [Bacillus halodurans] pir||E84093 immunity repressor protein (phage-related protein) BH3549 [imported] - Bacillus halodurans (strain C-125) dbj|BAB07268.1| immunity repressor protein (phage-related protein) [Bacillus halodurans] Length = 154 Score = 101 bits (252), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 49/98 (50%), Positives = 74/98 (75%), Gaps = 5/98 (5%) Query: 3 EEFGNYLRQLREQKGLTINQLASLAGISGAQISRIENGRRGVPKPATLRKIAEAADVPYE 62 ++FG+++R LR++KG T+NQLA +G+S AQISRIENG RGVPKP T++K++EA PYE Sbjct: 4 KQFGSFIRALRKKKGFTVNQLALYSGVSSAQISRIENGLRGVPKPETIKKLSEALGHPYE 63 Query: 63 ELMEHAGYLSEDMQSGAEDKVPEWATSKDKRDFRKMLE 100 +LM+ AGY+ ++ ++ +P T +D+RD +K LE Sbjct: 64 DLMQAAGYIDDNTKT----DLPAL-TERDERDIQKELE 96 >ref|NP_391246.1| similar to hypothetical proteins [Bacillus subtilis] pir||C70028 conserved hypothetical protein yvaN - Bacillus subtilis emb|CAB15371.1| yvaN [Bacillus subtilis subsp. subtilis str. 168] gb|AAB91590.1| Yvan [Bacillus subtilis] Length = 135 Score = 99.0 bits (245), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 46/77 (59%), Positives = 60/77 (77%) Query: 3 EEFGNYLRQLREQKGLTINQLASLAGISGAQISRIENGRRGVPKPATLRKIAEAADVPYE 62 E FG LR LRE++ LT+NQLA+ +G+S A ISRIENG+RGVPKPAT++K+AEA +PYE Sbjct: 2 ESFGEQLRALREERKLTVNQLATYSGVSAAGISRIENGKRGVPKPATIKKLAEALKIPYE 61 Query: 63 ELMEHAGYLSEDMQSGA 79 LM AGY+ E ++ A Sbjct: 62 GLMYKAGYIEEVHEARA 78 >ref|NP_391247.1| similar to hypothetical proteins [Bacillus subtilis] pir||D70028 conserved hypothetical protein yvaO - Bacillus subtilis emb|CAB15372.1| yvaO [Bacillus subtilis subsp. subtilis str. 168] Length = 139 Score = 86.7 bits (213), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 39/67 (58%), Positives = 50/67 (74%) Query: 5 FGNYLRQLREQKGLTINQLASLAGISGAQISRIENGRRGVPKPATLRKIAEAADVPYEEL 64 FG LR+LR + LT+NQLA +GIS A IS+IENG+RG PKPAT++K+A VPYE L Sbjct: 4 FGQQLRELRRARKLTVNQLAVYSGISSATISKIENGKRGTPKPATIKKLAAVLKVPYENL 63 Query: 65 MEHAGYL 71 M AG++ Sbjct: 64 MAAAGHI 70 >gb|AAB91591.1| Orf2 [Bacillus subtilis] Length = 139 Score = 86.7 bits (213), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 39/67 (58%), Positives = 50/67 (74%) Query: 5 FGNYLRQLREQKGLTINQLASLAGISGAQISRIENGRRGVPKPATLRKIAEAADVPYEEL 64 FG LR+LR + LT+NQLA +GIS A IS+IENG+RG PKPAT++K+A VPYE L Sbjct: 4 FGQQLRELRRARKLTVNQLAVYSGISSATISKIENGKRGTPKPATIKKLAAVLKVPYENL 63 Query: 65 MEHAGYL 71 M AG++ Sbjct: 64 MAAAGHI 70 >ref|NP_695143.1| repressor [Bacteriophage phig1e] pir||T13178 repressor protein - Lactobacillus phage phi-gle emb|CAA66782.1| repressor [Bacteriophage phig1e] emb|CAA62089.1| gp132 [Bacteriophage phig1e] Length = 132 Score = 69.7 bits (169), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 39/126 (30%), Positives = 70/126 (55%), Gaps = 10/126 (7%) Query: 5 FGNYLRQLREQKGLTINQLASLAGISGAQISRIENGRRGVPKPATLRKIAEAADVPYEEL 64 GN L++LR +G T +++A GIS A+ S +EN R P L+ +A +V + L Sbjct: 6 IGNRLKELRNMQGKTQDEVAKSIGISRARYSHLEN-ERNEPDNELLKLLASYYEVSTDYL 64 Query: 65 MEHAGYLSEDMQSGAEDKVPEWATSKDKRDFRKMLEDDGELMFDGIPLNKEDKQRIKDVL 124 + + S K P+WAT D+ D K+L+ + + + G+ + EDK+++++V+ Sbjct: 65 LGN---------SEKSHKSPDWATEADRIDLDKLLQSNTPMGYGGMSMAPEDKEKVRNVI 115 Query: 125 TGLFWD 130 G++WD Sbjct: 116 EGIYWD 121 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.313 0.132 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 223,217,479 Number of extensions: 8834160 Number of successful extensions: 22310 Number of sequences better than 1.0e-05: 15 Number of HSP's gapped: 22415 Number of HSP's successfully gapped: 15 Length of query: 149 Length of database: 757,237,578 Length adjustment: 108 Effective length of query: 41 Effective length of database: 464,006,886 Effective search space: 19024282326 Effective search space used: 19024282326 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)