BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0078.0029.p
         (67 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF 
           2,715,099 sequences; 757,237,578 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_561385.1| hypothetical protein [Clostridium perfringens] ...    55   6e-07

>ref|NP_561385.1| hypothetical protein [Clostridium perfringens]
 dbj|BAB80175.1| hypothetical protein [Clostridium perfringens str. 13]
          Length = 151

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 43/62 (69%), Gaps = 1/62 (1%)

Query: 1   MVRAVAGLKMLEKRGIESTLYMGVAKDKQGRMIAHAWLRSGSYYVSGDDAMKGFVVVEKF 60
           +V+A+   K+L+ +GI++TLY+GVAK++   M+AH+WLR G  +V+G +    +  V  F
Sbjct: 91  LVQAMTAQKILKDKGIKTTLYLGVAKERNN-MVAHSWLRYGQMFVTGGNGDLNYTRVGCF 149

Query: 61  AK 62
           AK
Sbjct: 150 AK 151


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 24, 2004  1:53 AM
  Number of letters in database: 757,237,578
  Number of sequences in database:  2,715,099
  
Lambda     K      H
   0.322    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 2715099
Number of Hits to DB: 88,617,208
Number of extensions: 2619721
Number of successful extensions: 4764
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 4766
Number of HSP's successfully gapped: 1
Length of query: 67
Length of database: 757,237,578
Length adjustment: 38
Effective length of query: 29
Effective length of database: 654,063,816
Effective search space: 18967850664
Effective search space used: 18967850664
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 120 (50.8 bits)