BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0074.0010.p (122 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_465003.1| similar to transcriptional regulator (MerR fami... 97 1e-19 ref|NP_785745.1| transcription regulator [Lactobacillus plantaru... 97 1e-19 ref|NP_831485.1| Transcriptional regulator, MerR family [Bacillu... 95 4e-19 ref|NP_691706.1| transcriptional regulator [Oceanobacillus iheye... 91 1e-17 ref|NP_786333.1| transcription regulator [Lactobacillus plantaru... 88 7e-17 >ref|NP_465003.1| similar to transcriptional regulator (MerR family) [Listeria monocytogenes EGD-e] pir||AF1259 transcription regulator (MerR family) homolog lmo1478 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAC99556.1| lmo1478 [Listeria monocytogenes] Length = 145 Score = 96.7 bits (239), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 44/111 (39%), Positives = 71/111 (63%) Query: 5 SIGEAAAAYHIPESTLRYYEKQGLLPLMERDAAGRRLFSEMQMALLETVLRLKQTHMPIH 64 SI E + +++ TLRYY+KQGLLP + ++ +G R F+E + L+ T+ LK T MP+ Sbjct: 4 SIKEVSKIFNLSIYTLRYYDKQGLLPFVSKNQSGYREFTESDLNLIHTICCLKNTGMPLK 63 Query: 65 DIRQYIAWVIEGDSTTELRLEMMTKHKQAVLDEIASMTDALQGIDVKIDRY 115 IR YI + +EG + E R +++ H+ AVL + +T+ L+ +DVKI +Y Sbjct: 64 QIRTYIDYCMEGPVSIEARKQLLLDHRAAVLKSLEDLTENLKEVDVKIAKY 114 >ref|NP_785745.1| transcription regulator [Lactobacillus plantarum WCFS1] emb|CAD64596.1| transcription regulator [Lactobacillus plantarum WCFS1] Length = 153 Score = 96.7 bits (239), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 49/111 (44%), Positives = 67/111 (60%) Query: 5 SIGEAAAAYHIPESTLRYYEKQGLLPLMERDAAGRRLFSEMQMALLETVLRLKQTHMPIH 64 SIG A I TLRYY+K GL P ++RD GRR+F++ + L + LKQT MP+ Sbjct: 3 SIGAVAKKTGISSYTLRYYDKAGLTPFVKRDKQGRRVFNDEDLDSLALIRCLKQTGMPLE 62 Query: 65 DIRQYIAWVIEGDSTTELRLEMMTKHKQAVLDEIASMTDALQGIDVKIDRY 115 DIRQ+I+W +GD T + RL M + +QAV +I LQ ++ KID Y Sbjct: 63 DIRQFISWCADGDGTIDQRLAMFEEQRQAVEAQIHQSLLNLQKVNHKIDVY 113 >ref|NP_831485.1| Transcriptional regulator, MerR family [Bacillus cereus ATCC 14579] gb|AAP08686.1| Transcriptional regulator, MerR family [Bacillus cereus ATCC 14579] Length = 126 Score = 95.1 bits (235), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 46/113 (40%), Positives = 67/113 (59%) Query: 3 YVSIGEAAAAYHIPESTLRYYEKQGLLPLMERDAAGRRLFSEMQMALLETVLRLKQTHMP 62 Y +IG+ A H+ S +RYY+KQGL P ++R+ G R+F E + LE +L LK T MP Sbjct: 2 YYTIGQVAKMQHLTISQIRYYDKQGLFPFLQRNEKGDRVFDEEALKYLEMILCLKNTSMP 61 Query: 63 IHDIRQYIAWVIEGDSTTELRLEMMTKHKQAVLDEIASMTDALQGIDVKIDRY 115 I I+Q+I W +EG+ST RL +M + + VL + L+ I KI +Y Sbjct: 62 IQKIKQFIDWSMEGESTILQRLALMKQQETNVLQLMQDTEKNLKKIQQKIAKY 114 >ref|NP_691706.1| transcriptional regulator [Oceanobacillus iheyensis HTE831] dbj|BAC12741.1| transcriptional regulator [Oceanobacillus iheyensis HTE831] Length = 138 Score = 90.5 bits (223), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 47/120 (39%), Positives = 67/120 (55%) Query: 1 MKYVSIGEAAAAYHIPESTLRYYEKQGLLPLMERDAAGRRLFSEMQMALLETVLRLKQTH 60 MK SI E A ++ TLRYY+K+GLLP +ER G RLF + + L + LK T Sbjct: 1 MKTYSISEVANKLNLTVYTLRYYDKEGLLPFVERKDNGTRLFKDADIEALHIIECLKSTG 60 Query: 61 MPIHDIRQYIAWVIEGDSTTELRLEMMTKHKQAVLDEIASMTDALQGIDVKIDRYLTRLQ 120 MPI +I+ +I W EGD+T + R ++ + K V ++ +T + ID K D Y T L Sbjct: 61 MPIKEIKNFIDWCGEGDATLQQRYDLFVERKANVEAQLEELTKTMAIIDHKCDYYKTALN 120 >ref|NP_786333.1| transcription regulator [Lactobacillus plantarum WCFS1] emb|CAD65193.1| transcription regulator [Lactobacillus plantarum WCFS1] Length = 147 Score = 87.8 bits (216), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 43/111 (38%), Positives = 69/111 (62%) Query: 5 SIGEAAAAYHIPESTLRYYEKQGLLPLMERDAAGRRLFSEMQMALLETVLRLKQTHMPIH 64 +I E A + TLR+Y+KQGLLP + R+ +G R F++ + LL T++ LK T M I Sbjct: 4 TIKEVADKVGLSAYTLRFYDKQGLLPFVSRNESGYRAFTDGDLHLLHTIICLKNTGMAIS 63 Query: 65 DIRQYIAWVIEGDSTTELRLEMMTKHKQAVLDEIASMTDALQGIDVKIDRY 115 IRQYI++V+ G + R E++T H+ A+L + A + L+ +D K++ Y Sbjct: 64 AIRQYISYVMAGPQSIAQRRELLTTHRNAILAQQAQIMKNLKEVDYKLNLY 114 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.321 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 153,627,980 Number of extensions: 4988203 Number of successful extensions: 16507 Number of sequences better than 1.0e-05: 72 Number of HSP's gapped: 16546 Number of HSP's successfully gapped: 72 Length of query: 122 Length of database: 757,237,578 Length adjustment: 86 Effective length of query: 36 Effective length of database: 523,739,064 Effective search space: 18854606304 Effective search space used: 18854606304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)