BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0069.0010.p (118 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_388649.1| similar to hypothetical proteins from B. subtil... 80 2e-14 ref|NP_389570.1| similar to hypothetical proteins from B. subtil... 66 2e-10 ref|NP_243256.1| BH2390~unknown conserved protein in B. subtilis... 64 7e-10 ref|NP_657751.1| hypothetical protein predicted by GeneMark [Bac... 64 1e-09 ref|NP_833507.1| IG hypothetical 16623 [Bacillus cereus ATCC 145... 64 1e-09 >ref|NP_388649.1| similar to hypothetical proteins from B. subtilis [Bacillus subtilis] pir||F69810 conserved hypothetical protein yflH - Bacillus subtilis dbj|BAA22301.1| YflH [Bacillus subtilis] emb|CAB12597.1| yflH [Bacillus subtilis subsp. subtilis str. 168] Length = 104 Score = 80.1 bits (196), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 38/80 (47%), Positives = 56/80 (70%) Query: 37 KDVILKNFEDFRSYLRKRIQLAQKIGLGEEQLXXXXEKIADYLAAHEEPRNSEEKLLLEL 96 K+ ILK+FE+F+ YL+K++ +K+GL + +L + DYLA HEEP+N EE LL EL Sbjct: 22 KEDILKDFEEFKGYLKKQVNRGKKLGLDDGKLVKSAAILGDYLAKHEEPQNGEEMLLQEL 81 Query: 97 WKVGSKEERQRLAHMLVKLA 116 W V ++E++ LA +LVKL Sbjct: 82 WSVADEDEKEHLAQLLVKLV 101 >ref|NP_389570.1| similar to hypothetical proteins from B. subtilis [Bacillus subtilis] pir||A69886 conserved hypothetical protein ymfJ - Bacillus subtilis emb|CAB13561.1| ymfJ [Bacillus subtilis subsp. subtilis str. 168] Length = 85 Score = 66.2 bits (160), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 28/79 (35%), Positives = 51/79 (64%) Query: 40 ILKNFEDFRSYLRKRIQLAQKIGLGEEQLXXXXEKIADYLAAHEEPRNSEEKLLLELWKV 99 +L+N++ ++++L R+ AQ G+ ++ + +I YLA E +N +EK+L +LW V Sbjct: 3 VLENWDSWKNFLGDRLNYAQDKGMSQDTITDLATEIGSYLANEVESKNEQEKVLADLWSV 62 Query: 100 GSKEERQRLAHMLVKLARN 118 SK+E+ +A+M+VKL N Sbjct: 63 ASKDEQHAIANMMVKLVEN 81 >ref|NP_243256.1| BH2390~unknown conserved protein in B. subtilis [Bacillus halodurans] pir||F83948 hypothetical protein BH2390 [imported] - Bacillus halodurans (strain C-125) dbj|BAB06109.1| BH2390~unknown conserved protein in B. subtilis [Bacillus halodurans] Length = 84 Score = 64.3 bits (155), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 28/79 (35%), Positives = 53/79 (67%) Query: 40 ILKNFEDFRSYLRKRIQLAQKIGLGEEQLXXXXEKIADYLAAHEEPRNSEEKLLLELWKV 99 +L N+E ++ +L R+Q A+ G+ + + ++ +YLA EP+N +E++L +LWKV Sbjct: 3 VLDNWEQWKDFLGDRLQQAESEGMNDGVISDVAYQVGEYLAKQVEPQNEQERILADLWKV 62 Query: 100 GSKEERQRLAHMLVKLARN 118 ++EE+ +A+M+VKL R+ Sbjct: 63 ANEEEQHAIANMMVKLVRS 81 >ref|NP_657751.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_846167.1| conserved hypothetical protein [Bacillus anthracis str. Ames] ref|NP_980116.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAP27653.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAS42724.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 82 Score = 63.9 bits (154), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 30/79 (37%), Positives = 51/79 (64%) Query: 40 ILKNFEDFRSYLRKRIQLAQKIGLGEEQLXXXXEKIADYLAAHEEPRNSEEKLLLELWKV 99 +L NF+ ++S+L +R++ AQ GL + ++ DYLA E RN +EKLL ELWKV Sbjct: 3 VLDNFDQWKSFLGERLEQAQGKGLDGGAVSDMAFRVGDYLANEVEARNDQEKLLAELWKV 62 Query: 100 GSKEERQRLAHMLVKLARN 118 ++E+ +A+++VK ++ Sbjct: 63 ADEQEQHTIANLMVKFVQH 81 >ref|NP_833507.1| IG hypothetical 16623 [Bacillus cereus ATCC 14579] gb|AAP10708.1| IG hypothetical 16623 [Bacillus cereus ATCC 14579] Length = 81 Score = 63.5 bits (153), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 30/78 (38%), Positives = 50/78 (64%) Query: 40 ILKNFEDFRSYLRKRIQLAQKIGLGEEQLXXXXEKIADYLAAHEEPRNSEEKLLLELWKV 99 +L NF+ ++S+L +R++ AQ GL + ++ DYLA E RN +EKLL ELWKV Sbjct: 3 VLDNFDQWKSFLGERLEQAQDKGLDGGAVSDMAFRVGDYLANEVEGRNDQEKLLAELWKV 62 Query: 100 GSKEERQRLAHMLVKLAR 117 ++E+ +A+++VK + Sbjct: 63 ADEQEQHTIANLMVKFVQ 80 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.314 0.132 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 157,184,057 Number of extensions: 5470474 Number of successful extensions: 16000 Number of sequences better than 1.0e-05: 6 Number of HSP's gapped: 16000 Number of HSP's successfully gapped: 6 Length of query: 118 Length of database: 757,237,578 Length adjustment: 83 Effective length of query: 35 Effective length of database: 531,884,361 Effective search space: 18615952635 Effective search space used: 18615952635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 120 (50.8 bits)