BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0056.0003.p (167 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_241158.1| BH0292~unknown conserved protein in others [Bac... 129 2e-29 ref|NP_978060.1| conserved domain protein [Bacillus cereus ATCC ... 113 2e-24 ref|NP_655525.1| HTH_ARSR, helix_turn_helix, Arsenical Resistanc... 110 1e-23 ref|NP_562551.1| probable transcriptional regulator [Clostridium... 61 8e-09 ref|NP_143761.1| hypothetical protein PH1932 [Pyrococcus horikos... 60 2e-08 >ref|NP_241158.1| BH0292~unknown conserved protein in others [Bacillus halodurans] pir||D83686 hypothetical protein BH0292 [imported] - Bacillus halodurans (strain C-125) dbj|BAB04011.1| BH0292~unknown conserved protein in others [Bacillus halodurans] Length = 177 Score = 129 bits (324), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 65/153 (42%), Positives = 96/153 (62%), Gaps = 6/153 (3%) Query: 16 LKVSPEQEKLLESALRIKIMHLLAAEPLTSKQVAEKLEKTPGNVHYHISKLFEGGLLELV 75 L +S EQ KLL SALR+KI+H L P T+KQVA++L +TPGN+HYHI +L+EG L++L+ Sbjct: 8 LSISIEQSKLLGSALRVKILHALEDVPKTAKQVADQLGQTPGNIHYHIQRLYEGQLIDLI 67 Query: 76 RTEAAGGIIQKFYRSKATWFRAENFSGFQFRAEDQVDHFTTRLTLSPEELESFRREMMDF 135 T+ GGI++K+YR+K+TWF ++ S + TTRL L+ E+LE F+ ++ D Sbjct: 68 ETKEIGGIVEKYYRAKSTWFNLKSDSK-SVSGDASATRITTRLLLTTEQLEQFQSDLRDV 126 Query: 136 ISSWESRVTLGT-----EYGVDIVIGHLRTPEP 163 + W + EY VDI + + EP Sbjct: 127 LDQWGRKSPQDDWEGLLEYAVDISLREVNHEEP 159 >ref|NP_978060.1| conserved domain protein [Bacillus cereus ATCC 10987] gb|AAS40668.1| conserved domain protein [Bacillus cereus ATCC 10987] Length = 149 Score = 113 bits (282), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 59/128 (46%), Positives = 84/128 (65%), Gaps = 3/128 (2%) Query: 16 LKVSPEQEKLLESALRIKIMHLLAAEPLTSKQVAEKLEKTPGNVHYHISKLFEGGLLELV 75 L +S EQ+KL+ +A RI+I+HLL E LT+KQVA KL K+ G+VHYH+ L++GGLLELV Sbjct: 6 LTISAEQQKLISNATRIQILHLLKDEALTAKQVATKLNKSAGSVHYHVQILYDGGLLELV 65 Query: 76 RTEAAGGIIQKFYRSKATWFRAENFSGFQFRAEDQVDHFTTRLTLSPEELESFRREMMDF 135 T+ GII+K+Y++KA F E SG + D H + L L+PEEL+ E+ Sbjct: 66 DTKEKRGIIEKYYKAKAAHFYIEE-SGTEGTNTD--SHIVSHLFLTPEELQQLTWEVTQV 122 Query: 136 ISSWESRV 143 + WE++ Sbjct: 123 LLRWENKT 130 >ref|NP_655525.1| HTH_ARSR, helix_turn_helix, Arsenical Resistance Operon Repressor [Bacillus anthracis A2012] ref|NP_844098.1| conserved domain protein [Bacillus anthracis str. Ames] gb|AAP25584.1| conserved domain protein [Bacillus anthracis str. Ames] Length = 149 Score = 110 bits (275), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 57/128 (44%), Positives = 84/128 (65%), Gaps = 3/128 (2%) Query: 16 LKVSPEQEKLLESALRIKIMHLLAAEPLTSKQVAEKLEKTPGNVHYHISKLFEGGLLELV 75 L +S EQ+KL+ +A RI+I+HLL E LT+KQVA KL K+ G+VHYH+ L++GGLLELV Sbjct: 6 LTISAEQQKLISNATRIQILHLLKNEALTAKQVATKLNKSTGSVHYHVQILYDGGLLELV 65 Query: 76 RTEAAGGIIQKFYRSKATWFRAENFSGFQFRAEDQVDHFTTRLTLSPEELESFRREMMDF 135 T+ GII+K+Y++K+ F E SG + + H + L L+PEEL+ E+ Sbjct: 66 DTKEKRGIIEKYYKAKSAHFYIEE-SGTE--GTNTGSHIVSHLFLTPEELQQLTWEVTQV 122 Query: 136 ISSWESRV 143 + WE++ Sbjct: 123 LLRWENKT 130 >ref|NP_562551.1| probable transcriptional regulator [Clostridium perfringens] dbj|BAB81341.1| probable transcriptional regulator [Clostridium perfringens str. 13] Length = 188 Score = 61.2 bits (147), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 5/119 (4%) Query: 21 EQEKLLESALRIKIMHLL--AAEPLTSKQVAEKLEKTPGNVHYHISKLFEGGLLELVRTE 78 EQ K R+KI+ L E T K++A+ + P VHYHI KL + G+LELV+T+ Sbjct: 11 EQIKAYSDPYRLKIITYLRNNQESATVKEIADFFGEVPAKVHYHIKKLEKAGILELVKTK 70 Query: 79 AAGGIIQKFYRSKATWFRAENFSGFQFRAEDQVDHFTTRLTLSPEELESFRREMMDFIS 137 GII K+Y A F N G Q + E + + + L + E +S + + M IS Sbjct: 71 EIKGIIAKYYYLTAESF---NIEGNQIKKEAKQVYKSQILNILSEYYDSSKEQTMKRIS 126 >ref|NP_143761.1| hypothetical protein PH1932 [Pyrococcus horikoshii] pir||D71208 hypothetical protein PH1932 - Pyrococcus horikoshii dbj|BAA31059.1| 192aa long hypothetical protein [Pyrococcus horikoshii] Length = 192 Score = 60.1 bits (144), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 32/84 (38%), Positives = 49/84 (58%) Query: 19 SPEQEKLLESALRIKIMHLLAAEPLTSKQVAEKLEKTPGNVHYHISKLFEGGLLELVRTE 78 PE K++ R KI+ LL + +T Q++E L KTP +++HI KL E GL+E+ RTE Sbjct: 10 DPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTE 69 Query: 79 AAGGIIQKFYRSKATWFRAENFSG 102 G +++K+Y A F + G Sbjct: 70 MKGNLVEKYYGRTADVFYINLYLG 93 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.316 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 242,945,611 Number of extensions: 8728713 Number of successful extensions: 24441 Number of sequences better than 1.0e-05: 11 Number of HSP's gapped: 24442 Number of HSP's successfully gapped: 11 Length of query: 167 Length of database: 757,237,578 Length adjustment: 116 Effective length of query: 51 Effective length of database: 442,286,094 Effective search space: 22556590794 Effective search space used: 22556590794 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 121 (51.2 bits)