BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0044.0007.p
         (55 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF 
           2,715,099 sequences; 757,237,578 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_624197.1| hypothetical protein [Thermoanaerobacter tengco...    57   9e-08

>ref|NP_624197.1| hypothetical protein [Thermoanaerobacter tengcongensis]
 gb|AAM25801.1| hypothetical protein [Thermoanaerobacter tengcongensis]
          Length = 55

 Score = 57.4 bits (137), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 38/55 (69%)

Query: 1  MYVVCKEHVELAIDKFVDEYEDAPDIVDLKETEFSDWDPPAKCAECDKNAEVLVV 55
          MYVVC++H+E AI++FV+ YE  PDI  L E  F+DW  P KC  CD+  + LVV
Sbjct: 1  MYVVCEKHLEDAIEEFVEVYEQPPDIYKLDEVSFTDWLAPHKCDFCDEPPKYLVV 55


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 24, 2004  1:53 AM
  Number of letters in database: 757,237,578
  Number of sequences in database:  2,715,099
  
Lambda     K      H
   0.317    0.136    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 2715099
Number of Hits to DB: 86,279,091
Number of extensions: 2563421
Number of successful extensions: 6759
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 6759
Number of HSP's successfully gapped: 1
Length of query: 55
Length of database: 757,237,578
Length adjustment: 27
Effective length of query: 28
Effective length of database: 683,929,905
Effective search space: 19150037340
Effective search space used: 19150037340
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 120 (50.8 bits)