BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0044.0004.p
         (126 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF 
           2,715,099 sequences; 757,237,578 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_244824.1| BH3956~unknown [Bacillus halodurans] >gi|254911...    68   6e-11

>ref|NP_244824.1| BH3956~unknown [Bacillus halodurans]
 pir||D84144 hypothetical protein BH3956 [imported] - Bacillus halodurans
           (strain C-125)
 dbj|BAB07675.1| BH3956~unknown [Bacillus halodurans]
          Length = 54

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (75%)

Query: 75  IQAMYTELIGKGVAFTGEPHMVNKMGQTETWMAFFRDSEGNTHALMSEV 123
           I+ +Y +L  +GV F  EPH+V K+GQTETWM FF D+EGNT A MSEV
Sbjct: 4   IKEIYEKLTDEGVTFIDEPHVVAKVGQTETWMTFFHDTEGNTDAFMSEV 52


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 24, 2004  1:53 AM
  Number of letters in database: 757,237,578
  Number of sequences in database:  2,715,099
  
Lambda     K      H
   0.321    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 2715099
Number of Hits to DB: 167,566,299
Number of extensions: 5465023
Number of successful extensions: 8844
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 8847
Number of HSP's successfully gapped: 1
Length of query: 126
Length of database: 757,237,578
Length adjustment: 89
Effective length of query: 37
Effective length of database: 515,593,767
Effective search space: 19076969379
Effective search space used: 19076969379
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 120 (50.8 bits)