BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0043.0032.p (90 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_244647.1| 50S ribosomal protein L31; ribosomal protein L3... 120 1e-26 ref|NP_390948.1| similar to hypothetical proteins [Bacillus subt... 117 1e-25 ref|NP_693922.1| 50S ribosomal protein L31 [Oceanobacillus iheye... 114 6e-25 ref|NP_765273.1| 50S ribosomal protein L31 [Staphylococcus epide... 114 7e-25 ref|NP_653790.1| Ribosomal_L31, Ribosomal protein L31 [Bacillus ... 111 5e-24 >ref|NP_244647.1| 50S ribosomal protein L31; ribosomal protein L31 [Bacillus halodurans] sp|Q9K6E9|R31B_BACHD 50S ribosomal protein L31 type B pir||D84122 ribosomal protein L31 rpmE [imported] - Bacillus halodurans (strain C-125) dbj|BAB07499.1| 50S ribosomal protein L31 [Bacillus halodurans] Length = 81 Score = 120 bits (301), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 53/81 (65%), Positives = 67/81 (82%) Query: 9 MKEGIHPKFNQVIFLDASVGFKFLSSSTKSSNETMEWEDGNTYPVIRVDSSSASHPFYTG 68 MK GIHP + +V+F+D S GFKFLS STK+SNET+EWEDGNTYP+I+V+ SS SHPFYTG Sbjct: 1 MKPGIHPDYKKVVFMDTSTGFKFLSGSTKTSNETIEWEDGNTYPLIKVEISSDSHPFYTG 60 Query: 69 KQRDTETGGRVDKFKQRLAQK 89 KQ+ + GGRVD+FK++ K Sbjct: 61 KQKLADAGGRVDRFKKKYNLK 81 >ref|NP_390948.1| similar to hypothetical proteins [Bacillus subtilis] sp|O34967|R31B_BACSU 50S ribosomal protein L31 type B pir||E69993 conserved hypothetical protein ytiA - Bacillus subtilis gb|AAC00233.1| YtiA [Bacillus subtilis] emb|CAB15048.1| ytiA [Bacillus subtilis subsp. subtilis str. 168] Length = 82 Score = 117 bits (292), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 52/77 (67%), Positives = 67/77 (87%) Query: 9 MKEGIHPKFNQVIFLDASVGFKFLSSSTKSSNETMEWEDGNTYPVIRVDSSSASHPFYTG 68 MKEGIHPK ++VIF D + G++FLS+STK+SNET EWEDGNTYPVI+V+ SS +HPFYTG Sbjct: 1 MKEGIHPKNHKVIFQDVNSGYRFLSTSTKTSNETAEWEDGNTYPVIKVEVSSDTHPFYTG 60 Query: 69 KQRDTETGGRVDKFKQR 85 +Q+ E GGRV++FK+R Sbjct: 61 RQKFNEKGGRVEQFKKR 77 >ref|NP_693922.1| 50S ribosomal protein L31 [Oceanobacillus iheyensis HTE831] sp|Q8EM58|R31B_OCEIH 50S ribosomal protein L31 type B dbj|BAC14956.1| 50S ribosomal protein L31 [Oceanobacillus iheyensis HTE831] Length = 81 Score = 114 bits (285), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 50/77 (64%), Positives = 65/77 (84%) Query: 9 MKEGIHPKFNQVIFLDASVGFKFLSSSTKSSNETMEWEDGNTYPVIRVDSSSASHPFYTG 68 MK+ IHP++ +V+FLD S FKFLS STK S+ET+EWEDGNTYP+I+V+ SS SHPFYTG Sbjct: 1 MKKDIHPEYKKVVFLDTSTNFKFLSGSTKGSDETIEWEDGNTYPLIKVEISSDSHPFYTG 60 Query: 69 KQRDTETGGRVDKFKQR 85 KQ+ + GGRVD+FK++ Sbjct: 61 KQKADKVGGRVDRFKKK 77 >ref|NP_765273.1| 50S ribosomal protein L31 [Staphylococcus epidermidis ATCC 12228] sp|Q8CRM8|R31B_STAEP 50S ribosomal protein L31 type B gb|AAO05317.1| 50S ribosomal protein L31 [Staphylococcus epidermidis ATCC 12228] Length = 85 Score = 114 bits (285), Expect = 7e-25, Method: Compositional matrix adjust. Identities = 50/81 (61%), Positives = 65/81 (80%) Query: 9 MKEGIHPKFNQVIFLDASVGFKFLSSSTKSSNETMEWEDGNTYPVIRVDSSSASHPFYTG 68 MK+GIHP++++VIFLD + FKFLS STK+S+ETMEWEDGN YPVIR+D SS SHPFYTG Sbjct: 1 MKQGIHPEYHKVIFLDTTTNFKFLSGSTKTSSETMEWEDGNEYPVIRLDVSSDSHPFYTG 60 Query: 69 KQRDTETGGRVDKFKQRLAQK 89 +Q+ GRV++F ++ K Sbjct: 61 RQKFAAADGRVERFNKKFGLK 81 >ref|NP_653790.1| Ribosomal_L31, Ribosomal protein L31 [Bacillus anthracis A2012] ref|NP_847731.1| ribosomal protein L31 [Bacillus anthracis str. Ames] sp|Q814T9|R31B_BACCR 50S ribosomal protein L31 type B sp|Q81JW9|R31B_BACAA 50S ribosomal protein L31 type B gb|AAP29217.1| ribosomal protein L31 [Bacillus anthracis str. Ames] Length = 81 Score = 111 bits (278), Expect = 5e-24, Method: Compositional matrix adjust. Identities = 48/81 (59%), Positives = 63/81 (77%) Query: 9 MKEGIHPKFNQVIFLDASVGFKFLSSSTKSSNETMEWEDGNTYPVIRVDSSSASHPFYTG 68 MK GIHP + +V+F+D + GFKFLS STK SNET+EWEDGNTYP+++V+ SS SHPFYTG Sbjct: 1 MKAGIHPDYKKVVFMDTNTGFKFLSGSTKGSNETVEWEDGNTYPLLKVEISSDSHPFYTG 60 Query: 69 KQRDTETGGRVDKFKQRLAQK 89 +Q+ GRVD+F ++ K Sbjct: 61 RQKFATADGRVDRFNKKYGLK 81 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.312 0.128 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 133,472,345 Number of extensions: 4520848 Number of successful extensions: 7868 Number of sequences better than 1.0e-05: 208 Number of HSP's gapped: 7813 Number of HSP's successfully gapped: 208 Length of query: 90 Length of database: 757,237,578 Length adjustment: 59 Effective length of query: 31 Effective length of database: 597,046,737 Effective search space: 18508448847 Effective search space used: 18508448847 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)