BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0043.0014.p (124 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_388229.1| similar to hypothetical proteins [Bacillus subt... 155 3e-37 emb|CAE02628.1| transcriptional regulator [Bacillus amyloliquefa... 154 8e-37 ref|NP_693727.1| hypothetical protein OB2805 [Oceanobacillus ihe... 153 9e-37 ref|NP_658350.1| DUF24, Protein of unknown function DUF24 [Bacil... 144 5e-34 ref|NP_834028.1| Transcriptional regulator, MarR family [Bacillu... 143 1e-33 >ref|NP_388229.1| similar to hypothetical proteins [Bacillus subtilis] sp|P42406|YCKH_BACSU Hypothetical protein yckH pir||B69761 conserved hypothetical protein yckH - Bacillus subtilis emb|CAB12141.1| hxlR [Bacillus subtilis subsp. subtilis str. 168] Length = 120 Score = 155 bits (391), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 73/106 (68%), Positives = 88/106 (83%) Query: 7 DRINLKEINCEKELTLAVIGGKWKLIILWHLGLEGTKRFSELKKLIPHITQKMLTNQLRE 66 R++ K NCEKELTLAVIGGKWK++ILWHLG EGTKRF+ELK LIP ITQK+L NQLRE Sbjct: 2 SRMDDKRFNCEKELTLAVIGGKWKMLILWHLGKEGTKRFNELKTLIPDITQKILVNQLRE 61 Query: 67 LEEDQLVFRQVYAEVPPRVEYSLTEYGQSLLPVLRMMYDWGKNYGE 112 E+D +V R+VY VPP+VEYSLT +G+SL+P+L MY+WGK Y E Sbjct: 62 REQDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKGYME 107 >emb|CAE02628.1| transcriptional regulator [Bacillus amyloliquefaciens] Length = 120 Score = 154 bits (388), Expect = 8e-37, Method: Compositional matrix adjust. Identities = 72/106 (67%), Positives = 87/106 (82%) Query: 7 DRINLKEINCEKELTLAVIGGKWKLIILWHLGLEGTKRFSELKKLIPHITQKMLTNQLRE 66 R++ K NCEKELTLAVIGGKWK++I+WHLG EGTKRF+ELK LIP IT K+L NQLRE Sbjct: 2 SRMDKKTFNCEKELTLAVIGGKWKMLIMWHLGKEGTKRFNELKALIPDITHKILVNQLRE 61 Query: 67 LEEDQLVFRQVYAEVPPRVEYSLTEYGQSLLPVLRMMYDWGKNYGE 112 LE+D +V R+VY VPP+VEYSLT G+SL+P+L MY WGK+Y E Sbjct: 62 LEQDLIVHREVYPVVPPKVEYSLTAQGESLMPILDAMYKWGKDYME 107 >ref|NP_693727.1| hypothetical protein OB2805 [Oceanobacillus iheyensis HTE831] dbj|BAC14761.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 125 Score = 153 bits (387), Expect = 9e-37, Method: Compositional matrix adjust. Identities = 70/101 (69%), Positives = 88/101 (87%) Query: 12 KEINCEKELTLAVIGGKWKLIILWHLGLEGTKRFSELKKLIPHITQKMLTNQLRELEEDQ 71 ++ NCEKELTLAVIGGKWK++ILW+LG EGTKRF+ELK L+P+ITQ+ML NQLRELE D Sbjct: 7 RDFNCEKELTLAVIGGKWKMLILWYLGKEGTKRFNELKSLMPNITQRMLVNQLRELESDF 66 Query: 72 LVFRQVYAEVPPRVEYSLTEYGQSLLPVLRMMYDWGKNYGE 112 +V R+VY VPP+VEYSLTE G++L+P+L MYDWGK+Y + Sbjct: 67 IVHREVYPVVPPKVEYSLTERGKTLMPILEAMYDWGKDYKD 107 >ref|NP_658350.1| DUF24, Protein of unknown function DUF24 [Bacillus anthracis A2012] ref|NP_846766.1| conserved hypothetical protein [Bacillus anthracis str. Ames] ref|NP_980692.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAP28252.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAS43300.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 124 Score = 144 bits (364), Expect = 5e-34, Method: Compositional matrix adjust. Identities = 66/111 (59%), Positives = 87/111 (78%) Query: 4 EIKDRINLKEINCEKELTLAVIGGKWKLIILWHLGLEGTKRFSELKKLIPHITQKMLTNQ 63 +I+++I NCEKELTL++I GKWK++ILWHLG+EG RFSEL++L P I+ K+L+NQ Sbjct: 8 DIQEKIQNGNFNCEKELTLSIISGKWKVVILWHLGVEGPHRFSELQRLFPSISHKVLSNQ 67 Query: 64 LRELEEDQLVFRQVYAEVPPRVEYSLTEYGQSLLPVLRMMYDWGKNYGENV 114 L+EL ED +V R VY E+PPRVEY +TE G SLLP++ MMYDWGK E + Sbjct: 68 LKELMEDGIVDRTVYPEIPPRVEYYMTELGMSLLPIVEMMYDWGKMRMEQI 118 >ref|NP_834028.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] gb|AAP11229.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] Length = 124 Score = 143 bits (361), Expect = 1e-33, Method: Compositional matrix adjust. Identities = 66/111 (59%), Positives = 86/111 (77%) Query: 4 EIKDRINLKEINCEKELTLAVIGGKWKLIILWHLGLEGTKRFSELKKLIPHITQKMLTNQ 63 +I+D+I NCEKELTL++I GKWK++ILWHLG+E RFSEL++L P I+ K+L+NQ Sbjct: 8 DIQDKIQNGNFNCEKELTLSIISGKWKVVILWHLGVERPHRFSELQRLFPSISHKVLSNQ 67 Query: 64 LRELEEDQLVFRQVYAEVPPRVEYSLTEYGQSLLPVLRMMYDWGKNYGENV 114 L+EL ED +V R VY E+PPRVEY +TE G SLLP++ MMYDWGK E + Sbjct: 68 LKELMEDGIVDRTVYPEIPPRVEYYMTELGMSLLPIVEMMYDWGKMRMEQI 118 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.319 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 196,864,945 Number of extensions: 7278121 Number of successful extensions: 17904 Number of sequences better than 1.0e-05: 305 Number of HSP's gapped: 17790 Number of HSP's successfully gapped: 305 Length of query: 124 Length of database: 757,237,578 Length adjustment: 88 Effective length of query: 36 Effective length of database: 518,308,866 Effective search space: 18659119176 Effective search space used: 18659119176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)