BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0043.0012.p (143 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA19363.1| FUNCTION UNKNOWN, SIMILAR PRODUCT IN E. COLI, H.... 148 3e-35 ref|NP_388410.1| similar to hypothetical proteins [Bacillus subt... 148 4e-35 ref|NP_391934.1| similar to hypothetical proteins [Bacillus subt... 142 3e-33 ref|NP_241603.1| cinnamoyl ester hydrolase [Bacillus halodurans]... 126 1e-28 ref|NP_833059.1| Transcriptional regulator, MarR family [Bacillu... 121 5e-27 >dbj|BAA19363.1| FUNCTION UNKNOWN, SIMILAR PRODUCT IN E. COLI, H. INFLUENZAE AND SYNECHOCYSTIS. [Bacillus subtilis] Length = 142 Score = 148 bits (374), Expect = 3e-35, Method: Compositional matrix adjust. Identities = 71/115 (61%), Positives = 86/115 (74%), Gaps = 2/115 (1%) Query: 4 QRSRGAANSKDSQES--LQSTLDLIGGKWKGVLLYHLISGTKRFNEIRRLCPEITQRMLT 61 R G S D E +++TLD+IGGKWKG+LLYHLI G KRFNE R+L P+ITQRMLT Sbjct: 17 NRKLGIDYSSDDFEGCPVETTLDIIGGKWKGILLYHLIDGKKRFNEFRKLYPKITQRMLT 76 Query: 62 LQLRDLERSGLVHRKVYPQAPRKVEYSLTEWGRGLEAAILSIKSWGEAYREEFGK 116 LQLR+LER G++HR+VY Q P KVEYSLTE+GR LE IL +K WGE Y++ K Sbjct: 77 LQLRELERDGVIHREVYKQVPPKVEYSLTEFGRTLEPVILHMKDWGEKYKDRIDK 131 >ref|NP_388410.1| similar to hypothetical proteins [Bacillus subtilis] sp|P96673|YDEP_BACSU Hypothetical protein ydeP pir||B69779 conserved hypothetical protein ydeP - Bacillus subtilis emb|CAB12336.1| ydeP [Bacillus subtilis subsp. subtilis str. 168] Length = 128 Score = 148 bits (373), Expect = 4e-35, Method: Compositional matrix adjust. Identities = 71/115 (61%), Positives = 86/115 (74%), Gaps = 2/115 (1%) Query: 4 QRSRGAANSKDSQES--LQSTLDLIGGKWKGVLLYHLISGTKRFNEIRRLCPEITQRMLT 61 R G S D E +++TLD+IGGKWKG+LLYHLI G KRFNE R+L P+ITQRMLT Sbjct: 3 NRKLGIDYSSDDFEGCPVETTLDIIGGKWKGILLYHLIDGKKRFNEFRKLYPKITQRMLT 62 Query: 62 LQLRDLERSGLVHRKVYPQAPRKVEYSLTEWGRGLEAAILSIKSWGEAYREEFGK 116 LQLR+LER G++HR+VY Q P KVEYSLTE+GR LE IL +K WGE Y++ K Sbjct: 63 LQLRELERDGVIHREVYKQVPPKVEYSLTEFGRTLEPVILHMKDWGEKYKDRIDK 117 >ref|NP_391934.1| similar to hypothetical proteins [Bacillus subtilis] sp|P37486|YYBR_BACSU Hypothetical protein yybR pir||S65979 conserved hypothetical protein yybR - Bacillus subtilis dbj|BAA05185.1| unknown [Bacillus subtilis] emb|CAB16091.1| yybR [Bacillus subtilis subsp. subtilis str. 168] Length = 125 Score = 142 bits (357), Expect = 3e-33, Method: Compositional matrix adjust. Identities = 63/94 (67%), Positives = 77/94 (81%) Query: 19 LQSTLDLIGGKWKGVLLYHLISGTKRFNEIRRLCPEITQRMLTLQLRDLERSGLVHRKVY 78 ++ TLD+IGGKWKG+L YH+I G KRFNE RR+CP ITQRMLTLQLR+LE G+VHR+VY Sbjct: 16 VEFTLDVIGGKWKGILFYHMIDGKKRFNEFRRICPSITQRMLTLQLRELEADGIVHREVY 75 Query: 79 PQAPRKVEYSLTEWGRGLEAAILSIKSWGEAYRE 112 Q P KVEYSLTE+GR LE +L +K WGE+ R+ Sbjct: 76 HQVPPKVEYSLTEFGRTLEPIVLQMKEWGESNRD 109 >ref|NP_241603.1| cinnamoyl ester hydrolase [Bacillus halodurans] pir||A83742 cinnamoyl ester hydrolase BH0737 [imported] - Bacillus halodurans (strain C-125) dbj|BAB04456.1| cinnamoyl ester hydrolase [Bacillus halodurans] Length = 118 Score = 126 bits (317), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 55/93 (59%), Positives = 78/93 (83%) Query: 19 LQSTLDLIGGKWKGVLLYHLISGTKRFNEIRRLCPEITQRMLTLQLRDLERSGLVHRKVY 78 +++TLD+IGGKWKGV+LY+L+ +RFNE+RRL P ITQR+L+LQLR+LE+ G+VHR+V+ Sbjct: 16 VEATLDVIGGKWKGVILYYLLEEKRRFNELRRLMPGITQRILSLQLRELEKDGIVHREVF 75 Query: 79 PQAPRKVEYSLTEWGRGLEAAILSIKSWGEAYR 111 P+ P +VEYS+TE+GR LE I ++ WGE Y+ Sbjct: 76 PEVPPRVEYSITEFGRTLEPIINQMRDWGEEYK 108 >ref|NP_833059.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] gb|AAP10260.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] Length = 126 Score = 121 bits (303), Expect = 5e-27, Method: Compositional matrix adjust. Identities = 54/89 (60%), Positives = 70/89 (78%) Query: 19 LQSTLDLIGGKWKGVLLYHLISGTKRFNEIRRLCPEITQRMLTLQLRDLERSGLVHRKVY 78 +++ +++IGGKWKGV+LYHL+ GTKRFNE++RL P ITQRMLTLQLR+LE G++HR+VY Sbjct: 21 VEAMVEVIGGKWKGVILYHLLDGTKRFNELKRLKPNITQRMLTLQLRELEADGIIHREVY 80 Query: 79 PQAPRKVEYSLTEWGRGLEAAILSIKSWG 107 + P KVEYSLTE G L IL + W Sbjct: 81 REVPPKVEYSLTELGESLRPVILLMMEWA 109 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.316 0.133 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 215,598,609 Number of extensions: 8173959 Number of successful extensions: 21402 Number of sequences better than 1.0e-05: 289 Number of HSP's gapped: 21350 Number of HSP's successfully gapped: 289 Length of query: 143 Length of database: 757,237,578 Length adjustment: 104 Effective length of query: 39 Effective length of database: 474,867,282 Effective search space: 18519823998 Effective search space used: 18519823998 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)