BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0039.0002.p (167 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAK29516.1| unknown [environmental sequence] 106 2e-22 ref|NP_562185.1| probable spermidine/putrescine-binding protein ... 102 4e-21 ref|NP_437317.1| putative spermidineputrescine ABC transporter p... 85 7e-16 ref|NP_356234.1| AGR_L_890p [Agrobacterium tumefaciens] >gi|1793... 80 1e-14 ref|NP_814948.1| spermidine/putrescine ABC transporter, spermidi... 79 4e-14 >gb|EAK29516.1| unknown [environmental sequence] Length = 244 Score = 106 bits (264), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 48/97 (49%), Positives = 71/97 (73%), Gaps = 1/97 (1%) Query: 53 LVISTWGFSEDFFKESVYAPFEKEHNVKIVVEIGNNAERLNKIR-QGSSDVDVVYLSDYY 111 LVISTWG++ D K+ +Y PFEK++ V+IV+E GNNA RLNK++ + VD++YL+ Y Sbjct: 18 LVISTWGYNGDLLKKYIYEPFEKKYGVEIVLETGNNAARLNKLKLRKGQGVDLIYLASSY 77 Query: 112 AQQAINEGLFETIDRSKIPNLDKIYDIAKAPLGKEYG 148 AI GLFE I+R+ + NL +IY +A++P G++YG Sbjct: 78 TMDAIELGLFEKINRANLTNLSEIYPVARSPFGEDYG 114 >ref|NP_562185.1| probable spermidine/putrescine-binding protein 1 [Clostridium perfringens] dbj|BAB80975.1| probable spermidine/putrescine-binding protein 1 [Clostridium perfringens str. 13] Length = 348 Score = 102 bits (253), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 45/97 (46%), Positives = 71/97 (73%), Gaps = 1/97 (1%) Query: 53 LVISTWGFSEDFFKESVYAPFEKEHNVKIVVEIGNNAERLNKIRQG-SSDVDVVYLSDYY 111 LV+STWG +ED KE+V+ PF KEH V+IV++IGNN+ERL K++ +S +D+ YL++ + Sbjct: 34 LVVSTWGLNEDVLKETVFEPFAKEHGVEIVLDIGNNSERLTKMKNNPNSQIDITYLAESF 93 Query: 112 AQQAINEGLFETIDRSKIPNLDKIYDIAKAPLGKEYG 148 A+Q + G+F+ +D SKIPN ++ + AK+ + YG Sbjct: 94 AEQGVEAGIFDKLDYSKIPNASEMNEKAKSTVEAGYG 130 >ref|NP_437317.1| putative spermidineputrescine ABC transporter periplasmic solute-binding protein precursor [Sinorhizobium meliloti 1021] pir||A95939 probable spermidineputrescine ABC transporter periplasmic solute-binding protein precursor potD [imported] - Sinorhizobium meliloti (strain 1021) magaplasmid pSymB emb|CAC49177.1| putative spermidineputrescine ABC transporter periplasmic solute-binding protein precursor [Sinorhizobium meliloti] Length = 340 Score = 84.7 bits (208), Expect = 7e-16, Method: Compositional matrix adjust. Identities = 45/94 (47%), Positives = 59/94 (62%), Gaps = 2/94 (2%) Query: 53 LVISTWGFSEDFFKESVYAPFEKEHNVKIVVEIGNNAERLNKIRQGSSD--VDVVYLSDY 110 L IS +GF++D FKE VY PFE + K+VVE GN+ ERL K+ ++ VD+ +S Sbjct: 26 LTISVYGFAQDAFKELVYDPFEAKCGCKLVVETGNSVERLAKMEANKANPVVDMAVVSMA 85 Query: 111 YAQQAINEGLFETIDRSKIPNLDKIYDIAKAPLG 144 A A GL + ID SK+ N DK+YDIAK P G Sbjct: 86 DALSATRAGLIDKIDTSKLSNFDKLYDIAKDPNG 119 >ref|NP_356234.1| AGR_L_890p [Agrobacterium tumefaciens] ref|NP_534899.1| ABC transporter, substrate binding protein [spermidine/putrescine] [Agrobacterium tumefaciens str. C58 (U. Washington)] pir||A96187 probable mikimopine transporter gene similar to potd gene [imported] - Agrobacterium tumefaciens (strain C58, Cereon) pir||AI3099 hypothetical protein Atu4421 [imported] - Agrobacterium tumefaciens (strain C58, Dupont) gb|AAK89019.1| AGR_L_890p [Agrobacterium tumefaciens str. C58 (Cereon)] gb|AAL45215.1| ABC transporter, substrate binding protein [spermidine/putrescine] [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 340 Score = 80.5 bits (197), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 42/94 (44%), Positives = 59/94 (62%), Gaps = 2/94 (2%) Query: 53 LVISTWGFSEDFFKESVYAPFEKEHNVKIVVEIGNNAERLNKIRQGSSD--VDVVYLSDY 110 L IS + F++D FKE VY PFE + K+VVE GN+ ERL K+ ++ VD+ +S Sbjct: 26 LTISVYAFAQDEFKELVYTPFEAKCGCKLVVETGNSVERLAKMEANKANPVVDLAIVSMA 85 Query: 111 YAQQAINEGLFETIDRSKIPNLDKIYDIAKAPLG 144 A A + L + ID SK+PN++ +YDIAK P G Sbjct: 86 DALSATRKDLIQKIDASKVPNIENLYDIAKDPNG 119 >ref|NP_814948.1| spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Enterococcus faecalis V583] gb|AAO81018.1| spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Enterococcus faecalis V583] Length = 354 Score = 79.0 bits (193), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 37/89 (41%), Positives = 59/89 (66%), Gaps = 1/89 (1%) Query: 53 LVISTWGFSEDFFKESVYAPFEKEHNVKIVVEIGNNAERLNKIRQG-SSDVDVVYLSDYY 111 LV+ST+G SED K+ + APFEKE+ K+ +E+GN+A+R K++ ++ +DV+ L+ Sbjct: 38 LVVSTFGLSEDIVKKDIIAPFEKENEAKVTLEVGNSADRFTKLKNNPNAGIDVIELAQAN 97 Query: 112 AQQAINEGLFETIDRSKIPNLDKIYDIAK 140 A Q +GLFE I ++PNL ++ AK Sbjct: 98 AAQGGKDGLFEKITEKEVPNLSQLTPGAK 126 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.316 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 172,220,456 Number of extensions: 6083766 Number of successful extensions: 15960 Number of sequences better than 1.0e-05: 12 Number of HSP's gapped: 16051 Number of HSP's successfully gapped: 12 Length of query: 167 Length of database: 757,237,578 Length adjustment: 116 Effective length of query: 51 Effective length of database: 442,286,094 Effective search space: 22556590794 Effective search space used: 22556590794 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 121 (51.2 bits)