BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0035.0010.p (91 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_240925.1| BH0059~unknown conserved protein in B. subtilis... 131 6e-30 ref|NP_387925.1| veg [Bacillus subtilis] >gi|586231|sp|P37466|VE... 114 5e-25 ref|NP_765844.1| veg protein [Staphylococcus epidermidis ATCC 12... 110 8e-24 ref|NP_690974.1| hypothetical protein OB0053 [Oceanobacillus ihe... 110 9e-24 ref|NP_371018.1| VEG protein homologue [Staphylococcus aureus su... 108 3e-23 >ref|NP_240925.1| BH0059~unknown conserved protein in B. subtilis [Bacillus halodurans] pir||C83657 hypothetical protein BH0059 [imported] - Bacillus halodurans (strain C-125) dbj|BAB03778.1| BH0059 [Bacillus halodurans] Length = 88 Score = 131 bits (329), Expect = 6e-30, Method: Compositional matrix adjust. Identities = 58/77 (75%), Positives = 73/77 (94%) Query: 6 LLEIKRSLEAHVGHKITLRANGGRRKTVERTGVLEETYPSVFIVKLDQEQQTFKRVSYSY 65 L+EIKR+L+A+VG +IT++ANGGRRKT ER+G+LEETYPSVFI+KLD++Q F+RVSYSY Sbjct: 5 LVEIKRALDANVGKRITIKANGGRRKTTERSGLLEETYPSVFIIKLDEDQHAFERVSYSY 64 Query: 66 ADILTESVEITVCEDDG 82 ADILTE+VE+TVCEDDG Sbjct: 65 ADILTETVELTVCEDDG 81 >ref|NP_387925.1| veg [Bacillus subtilis] sp|P37466|VEG_BACSU Veg protein pir||S66073 veg protein - Bacillus subtilis dbj|BAA05279.1| unknown [Bacillus subtilis] emb|CAB11820.1| veg [Bacillus subtilis subsp. subtilis str. 168] Length = 86 Score = 114 bits (286), Expect = 5e-25, Method: Compositional matrix adjust. Identities = 48/75 (64%), Positives = 68/75 (90%) Query: 6 LLEIKRSLEAHVGHKITLRANGGRRKTVERTGVLEETYPSVFIVKLDQEQQTFKRVSYSY 65 L +IKRSL+ ++G ++TL+ANGGRRKT+ER+G+L ETYPSVF+++LDQ++ +F+RVSYSY Sbjct: 5 LSDIKRSLDGNLGKRLTLKANGGRRKTIERSGILAETYPSVFVIQLDQDENSFERVSYSY 64 Query: 66 ADILTESVEITVCED 80 ADILTE+VE+T +D Sbjct: 65 ADILTETVELTFNDD 79 >ref|NP_765844.1| veg protein [Staphylococcus epidermidis ATCC 12228] gb|AAO05931.1| veg protein [Staphylococcus epidermidis ATCC 12228] Length = 87 Score = 110 bits (276), Expect = 8e-24, Method: Compositional matrix adjust. Identities = 46/84 (54%), Positives = 72/84 (85%) Query: 5 ALLEIKRSLEAHVGHKITLRANGGRRKTVERTGVLEETYPSVFIVKLDQEQQTFKRVSYS 64 ++L+IK S++ H+G++I L+ANGGR+KT+ER+GVL+ETYPSVFIV+LDQ++ F+RVSY+ Sbjct: 4 SILDIKNSIDCHLGNRIVLKANGGRKKTIERSGVLKETYPSVFIVELDQDKHNFERVSYT 63 Query: 65 YADILTESVEITVCEDDGQMRIMY 88 Y D+LTE+V+++ ED+ Q + + Sbjct: 64 YTDVLTENVQVSFEEDNHQEAVAH 87 >ref|NP_690974.1| hypothetical protein OB0053 [Oceanobacillus iheyensis HTE831] dbj|BAC12009.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 82 Score = 110 bits (275), Expect = 9e-24, Method: Compositional matrix adjust. Identities = 49/70 (70%), Positives = 62/70 (88%) Query: 6 LLEIKRSLEAHVGHKITLRANGGRRKTVERTGVLEETYPSVFIVKLDQEQQTFKRVSYSY 65 L+EIK+ LE VG ++TL+ANGGRRKT+ER G+L ETYPSVFIV+LDQ++ F+RVSYSY Sbjct: 5 LIEIKQGLECQVGQRLTLKANGGRRKTIERCGILAETYPSVFIVELDQDENAFERVSYSY 64 Query: 66 ADILTESVEI 75 ADILTE+VE+ Sbjct: 65 ADILTETVEL 74 >ref|NP_371018.1| VEG protein homologue [Staphylococcus aureus subsp. aureus Mu50] ref|NP_373704.1| VEG protein homologue [Staphylococcus aureus subsp. aureus N315] ref|NP_645266.1| ORFID:MW0449~VEG protein homologue [Staphylococcus aureus subsp. aureus MW2] pir||G89815 hypothetical protein veg [imported] - Staphylococcus aureus (strain N315) dbj|BAB41682.1| veg [Staphylococcus aureus subsp. aureus N315] dbj|BAB56656.1| VEG protein homologue [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB94314.1| veg [Staphylococcus aureus subsp. aureus MW2] Length = 87 Score = 108 bits (271), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 45/84 (53%), Positives = 71/84 (84%) Query: 5 ALLEIKRSLEAHVGHKITLRANGGRRKTVERTGVLEETYPSVFIVKLDQEQQTFKRVSYS 64 ++L+IK S++ HVG++I L+ANGGR+KT++R+G+L+ETYPSVFIV+LDQ++ F+RVSY+ Sbjct: 4 SILDIKNSIDCHVGNRIVLKANGGRKKTIKRSGILKETYPSVFIVELDQDKHNFERVSYT 63 Query: 65 YADILTESVEITVCEDDGQMRIMY 88 Y D+LTE+V+++ ED+ I + Sbjct: 64 YTDVLTENVQVSFEEDNHHESIAH 87 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.133 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 116,507,113 Number of extensions: 3664966 Number of successful extensions: 8383 Number of sequences better than 1.0e-05: 19 Number of HSP's gapped: 8380 Number of HSP's successfully gapped: 19 Length of query: 91 Length of database: 757,237,578 Length adjustment: 59 Effective length of query: 32 Effective length of database: 597,046,737 Effective search space: 19105495584 Effective search space used: 19105495584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)