BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0035.0006.p (79 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_240930.1| stage V sporulation protein G [Bacillus halodur... 131 5e-30 ref|NP_690978.1| stage V sporulation protein G [Oceanobacillus i... 126 1e-28 ref|NP_976374.1| stage V sporulation protein G [Bacillus cereus ... 123 1e-27 ref|NP_653996.1| hypothetical protein predicted by GeneMark [Bac... 123 1e-27 ref|NP_469580.1| similar to B. subtilis SpoVG protein [Listeria ... 119 3e-26 >ref|NP_240930.1| stage V sporulation protein G [Bacillus halodurans] pir||H83657 stage V sporulation protein G spoVG [imported] - Bacillus halodurans (strain C-125) dbj|BAB03783.1| stage V sporulation protein G [Bacillus halodurans] Length = 97 Score = 131 bits (330), Expect = 5e-30, Method: Compositional matrix adjust. Identities = 62/67 (92%), Positives = 66/67 (98%) Query: 1 MKAIASITIDNEFVVHDIRVIDGNNGMFVAMPSKRTPDGEFRDIAHPISSGTREKIQSAV 60 MKAIASITID+EFVVHDIRVIDGNNG+FVAMPSKRTPDGEFRDIAHPISS TREKIQ+AV Sbjct: 17 MKAIASITIDHEFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDIAHPISSQTREKIQTAV 76 Query: 61 LAEYDRA 67 LAEY+RA Sbjct: 77 LAEYERA 83 >ref|NP_690978.1| stage V sporulation protein G [Oceanobacillus iheyensis HTE831] dbj|BAC12013.1| stage V sporulation protein G [Oceanobacillus iheyensis HTE831] Length = 96 Score = 126 bits (317), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 60/79 (75%), Positives = 65/79 (82%) Query: 1 MKAIASITIDNEFVVHDIRVIDGNNGMFVAMPSKRTPDGEFRDIAHPISSGTREKIQSAV 60 M+AIASIT+D EFVVHDIRVIDGNNG+FVAMPSKRTPDGEFRDIAHPI+SGTR KIQ AV Sbjct: 17 MRAIASITLDQEFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDIAHPINSGTRSKIQEAV 76 Query: 61 LAEYDRAATXXXXXXXXGA 79 LAEY +A GA Sbjct: 77 LAEYQKAGEDEVNYEEAGA 95 >ref|NP_976374.1| stage V sporulation protein G [Bacillus cereus ATCC 10987] gb|AAS38982.1| stage V sporulation protein G [Bacillus cereus ATCC 10987] Length = 115 Score = 123 bits (309), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 57/66 (86%), Positives = 62/66 (93%) Query: 1 MKAIASITIDNEFVVHDIRVIDGNNGMFVAMPSKRTPDGEFRDIAHPISSGTREKIQSAV 60 M+AIASIT+D+EFVVHDIRVIDGNNG+FVAMPSKRTPDGEFRDIAHPI+SGTR KIQ AV Sbjct: 35 MRAIASITLDHEFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDIAHPINSGTRSKIQDAV 94 Query: 61 LAEYDR 66 L EY R Sbjct: 95 LTEYHR 100 >ref|NP_653996.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_829950.1| Stage V sporulation protein G [Bacillus cereus ATCC 14579] ref|NP_842616.1| stage V sporulation protein G [Bacillus anthracis str. Ames] gb|AAP07151.1| Stage V sporulation protein G [Bacillus cereus ATCC 14579] gb|AAP24102.1| stage V sporulation protein G [Bacillus anthracis str. Ames] Length = 97 Score = 123 bits (308), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 57/66 (86%), Positives = 62/66 (93%) Query: 1 MKAIASITIDNEFVVHDIRVIDGNNGMFVAMPSKRTPDGEFRDIAHPISSGTREKIQSAV 60 M+AIASIT+D+EFVVHDIRVIDGNNG+FVAMPSKRTPDGEFRDIAHPI+SGTR KIQ AV Sbjct: 17 MRAIASITLDHEFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDIAHPINSGTRSKIQDAV 76 Query: 61 LAEYDR 66 L EY R Sbjct: 77 LTEYHR 82 >ref|NP_469580.1| similar to B. subtilis SpoVG protein [Listeria innocua] pir||AD1462 B. subtilis SpoVG protein homolog lin0235 [imported] - Listeria innocua (strain Clip11262) emb|CAC95468.1| lin0235 [Listeria innocua] Length = 102 Score = 119 bits (297), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 56/67 (83%), Positives = 61/67 (91%) Query: 1 MKAIASITIDNEFVVHDIRVIDGNNGMFVAMPSKRTPDGEFRDIAHPISSGTREKIQSAV 60 MKAI+SITID EFV+HDIRVIDGN G+FVAMPSKRTPDGEFRDIAHPI+SGTR KIQ AV Sbjct: 17 MKAISSITIDGEFVIHDIRVIDGNEGLFVAMPSKRTPDGEFRDIAHPINSGTRAKIQEAV 76 Query: 61 LAEYDRA 67 LA Y+ A Sbjct: 77 LAAYEVA 83 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 96,264,251 Number of extensions: 3051648 Number of successful extensions: 5801 Number of sequences better than 1.0e-05: 25 Number of HSP's gapped: 5802 Number of HSP's successfully gapped: 25 Length of query: 79 Length of database: 757,237,578 Length adjustment: 49 Effective length of query: 30 Effective length of database: 624,197,727 Effective search space: 18725931810 Effective search space used: 18725931810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)