BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0033.0017.p (185 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_391254.1| similar to hypothetical proteins [Bacillus subt... 123 2e-27 dbj|BAA21899.1| portion of orf between proU operon and 181 opero... 123 3e-27 ref|NP_391264.1| similar to hypothetical proteins from B. subtil... 120 1e-26 ref|NP_390985.1| similar to hypothetical proteins [Bacillus subt... 117 2e-25 ref|NP_765722.1| conserved hypothetical protein [Staphylococcus ... 115 6e-25 >ref|NP_391254.1| similar to hypothetical proteins [Bacillus subtilis] pir||G70028 conserved hypothetical protein yvaV - Bacillus subtilis emb|CAB15379.1| yvaV [Bacillus subtilis subsp. subtilis str. 168] gb|AAC14360.1| unknown [Bacillus subtilis] Length = 180 Score = 123 bits (308), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 69/171 (40%), Positives = 102/171 (59%), Gaps = 5/171 (2%) Query: 15 ISKARERVIDSIGKNMDLYGITLSIGHLYGYMYFNQGPVTLDELSRTMGMSKTSMSTGVR 74 I +A + I+ I +NM +G+ ++G + G +Y N+ P+TL ELS GMSKT MS VR Sbjct: 12 IEQAEDHFIERIAENMHAFGMPSTVGRVLGIIYMNRKPMTLTELSEATGMSKTRMSQVVR 71 Query: 75 TLLDLKMIDKVWGKGTRKDLFEVVPDWHQNFSDYFSIKWRKAVEGNMSALSKSLNEIRQM 134 +LD + +KV+ KG RKDL+EV D++Q F FS W K V N + K LN R++ Sbjct: 72 EMLDANIAEKVFEKGVRKDLYEVEQDYYQTFITLFSATWSKVVSKN-KMMHKKLN--REL 128 Query: 135 KSDYADE--PGVEQLLNTDEVKIEEAIKYYRWLLKLIEALETGKIFELIPK 183 S +E P E+ +N +++E + YY WL +LIE E+ IF+ +PK Sbjct: 129 LSVLDEELTPEAEEKVNELLKELKEWLDYYNWLSRLIEFFESEDIFKYVPK 179 >dbj|BAA21899.1| portion of orf between proU operon and 181 operon [Bacillus subtilis] Length = 174 Score = 123 bits (308), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 69/171 (40%), Positives = 102/171 (59%), Gaps = 5/171 (2%) Query: 15 ISKARERVIDSIGKNMDLYGITLSIGHLYGYMYFNQGPVTLDELSRTMGMSKTSMSTGVR 74 I +A + I+ I +NM +G+ ++G + G +Y N+ P+TL ELS GMSKT MS VR Sbjct: 6 IEQAEDHFIERIAENMHAFGMPSTVGRVLGIIYMNRKPMTLTELSEATGMSKTRMSQVVR 65 Query: 75 TLLDLKMIDKVWGKGTRKDLFEVVPDWHQNFSDYFSIKWRKAVEGNMSALSKSLNEIRQM 134 +LD + +KV+ KG RKDL+EV D++Q F FS W K V N + K LN R++ Sbjct: 66 EMLDANIAEKVFEKGVRKDLYEVEQDYYQTFITLFSATWSKVVSKN-KMMHKKLN--REL 122 Query: 135 KSDYADE--PGVEQLLNTDEVKIEEAIKYYRWLLKLIEALETGKIFELIPK 183 S +E P E+ +N +++E + YY WL +LIE E+ IF+ +PK Sbjct: 123 LSVLDEELTPEAEEKVNELLKELKEWLDYYNWLSRLIEFFESEDIFKYVPK 173 >ref|NP_391264.1| similar to hypothetical proteins from B. subtilis [Bacillus subtilis] pir||E70029 conserved hypothetical protein yvbF - Bacillus subtilis gb|AAB63772.1| ORF-1 [Bacillus subtilis] emb|CAB15389.1| yvbF [Bacillus subtilis subsp. subtilis str. 168] Length = 185 Score = 120 bits (301), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 66/173 (38%), Positives = 102/173 (58%), Gaps = 8/173 (4%) Query: 15 ISKARERVIDSIGKNMDLYGITLSIGHLYGYMYFNQGPVTLDELSRTMGMSKTSMSTGVR 74 I A E +I+ I +NM +G+ ++G + G +Y N+ P+TL ELS GMSKT MS VR Sbjct: 9 IEHAEEHLIEKIAENMHTFGMPSTVGRVLGIIYMNRKPMTLSELSEATGMSKTRMSQVVR 68 Query: 75 TLLDLKMIDKVWGKGTRKDLFEVVPDWHQNFSDYFSIKWRKAVEGN---MSALSKSLNEI 131 ++D + +KV+ KG RKDL++V D++Q F F+ W K V N L++ L+++ Sbjct: 69 EMIDANIAEKVFEKGVRKDLYDVEQDYYQTFISLFAANWTKVVSKNKVLYKKLNRELSDL 128 Query: 132 RQMKSDYAD-EPGVEQLLNTDEVKIEEAIKYYRWLLKLIEALETGKIFELIPK 183 Q + E V QLLN +++E + YY WL +LIE E+ ++F +PK Sbjct: 129 LQRDGLTPEAEEKVNQLLN----ELKEWLHYYDWLSRLIEFFESEEVFRYVPK 177 >ref|NP_390985.1| similar to hypothetical proteins [Bacillus subtilis] sp|P71015|YUAC_BACSU Hypothetical protein yuaC (ORF2) pir||E70005 conserved hypothetical protein yuaC - Bacillus subtilis gb|AAC44366.1| ORF-2 upstream of gbsAB operon emb|CAB15085.1| yuaC [Bacillus subtilis subsp. subtilis str. 168] Length = 180 Score = 117 bits (292), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 70/173 (40%), Positives = 112/173 (64%), Gaps = 5/173 (2%) Query: 15 ISKARERVIDSIGKNMDLYGITLSIGHLYGYMYFNQGPVTLDELSRTMGMSKTSMSTGVR 74 I +AR+ VIDSI + MDLYGIT S+G LYG MY + +TLDE+ + MSK SMSTGV+ Sbjct: 10 IEQARDLVIDSIAETMDLYGITRSVGILYGTMYM-RDEMTLDEMREELQMSKPSMSTGVK 68 Query: 75 TLLDLKMIDKVWGKGTRKDLFEVVPDWHQNFSDYFSIKWRKAVEGNMSALSKSLNEIRQM 134 L DL ++ K + +G RK F D+ + F+++F KW + V+ N++A+ ++ +++++ Sbjct: 69 KLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVTAIEEAQADLQKV 128 Query: 135 --KSDYADEPGVEQLLNTDEVKIEEAIKYYRWLLKLIEALETGKIFELIPKES 185 K D ++ E L D+ +E + YY WL +L E+++TG+IF+ IP E+ Sbjct: 129 LCKEDLDEDIKNEALQLYDQ--LESSKAYYDWLKRLAESVQTGEIFKFIPVET 179 >ref|NP_765722.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] gb|AAO05809.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] Length = 188 Score = 115 bits (287), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 68/170 (40%), Positives = 110/170 (64%), Gaps = 5/170 (2%) Query: 15 ISKARERVIDSIGKNMDLYGITLSIGHLYGYMYFNQGPVTLDELSRTMGMSKTSMSTGVR 74 I +A++ VI+SIG+ MDLYGI S+G+LYG M F +G +TLDE+ + + MSK SMSTGV+ Sbjct: 12 IEEAKDLVINSIGETMDLYGINRSVGNLYGIMVF-EGSMTLDEMRQQLQMSKPSMSTGVK 70 Query: 75 TLLDLKMIDKVWGKGTRKDLFEVVPDWHQNFSDYFSIKWRKAVEGNMSALSKSLNEIRQM 134 L + ++ + + +G+RK F D+ F ++F+ KW + ++ NM A+ + N I + Sbjct: 71 KLQEYDIVKQQFTRGSRKQHFIAEKDFFTFFRNFFTKKWEREIDTNMEAIEDAENIIHPL 130 Query: 135 --KSDYADEPGVEQLLNTDEVKIEEAIKYYRWLLKLIEALETGKIFELIP 182 K+D DE +Q +N + +++ + YY+WL +L EALE+G+IF P Sbjct: 131 LEKND-IDEEVKKQAINV-KAQLDHSKIYYKWLAQLSEALESGEIFNYFP 178 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 271,272,337 Number of extensions: 10337084 Number of successful extensions: 34262 Number of sequences better than 1.0e-05: 13 Number of HSP's gapped: 34253 Number of HSP's successfully gapped: 13 Length of query: 185 Length of database: 757,237,578 Length adjustment: 118 Effective length of query: 67 Effective length of database: 436,855,896 Effective search space: 29269345032 Effective search space used: 29269345032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 122 (51.6 bits)