BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0033.0012.p (555 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_388045.1| alternate gene name: yzbC~similar to transcript... 141 4e-32 ref|NP_347426.1| Ferrichrome-binding periplasmic proteinl, fhuD ... 82 3e-14 ref|NP_241717.1| transcriptional regulator (AraC/XylS family) [B... 81 6e-14 ref|NP_244709.1| two-component response regulator [Bacillus halo... 81 6e-14 ref|ZP_00180754.1| hypothetical protein Mther123301 [Moorella th... 80 1e-13 >ref|NP_388045.1| alternate gene name: yzbC~similar to transcriptional regulator (AraC/XylS family) [Bacillus subtilis] sp|P40408|YBBB_BACSU Putative HTH-type transcriptional regulator ybbB pir||I39841 transcription regulator AraC/XylS family homolog ybbB - Bacillus subtilis gb|AAA64353.1| putative initiation codon GUG. Homology with transcriptional regulators (Salmonella typhimurium AraC, Bacillus subtilis AdaA).; putative dbj|BAA19497.1| YbbB [Bacillus subtilis] emb|CAB11940.1| ybbB [Bacillus subtilis subsp. subtilis str. 168] Length = 529 Score = 141 bits (356), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 98/377 (25%), Positives = 183/377 (48%), Gaps = 22/377 (5%) Query: 180 SMERSITYLENHFSEKITREHLAAIAGVSRSHYSTLFKQLTGFTLNEYLSRLRVHRAKEL 239 ++E++ Y+E H KIT L+ +AG+S HYS FK+ TG ++ E++++ R+ +AK L Sbjct: 164 AIEKTKHYIETHADTKITLAQLSQMAGISAKHYSESFKKWTGQSVTEFITKTRITKAKRL 223 Query: 240 LLNSSGTLREIALKVGYKDEFYLSRRFKQETGTSPSGYNRKPIRHVAVLLTPYASHLLLL 299 + S+ L+EIA + GY+DEFY SR FK+ TG SP+ Y +K + +A HL+ L Sbjct: 224 MAKSNCKLKEIAHQTGYQDEFYFSRIFKKYTGCSPTSYMKKRRKKIAAYGRGTMGHLIPL 283 Query: 300 GLEP---AVTISESSEYLNLSGQEPPKPMKFINTNSSAAQMRSALLEANIELIIAARQHL 356 P A+ +S Y + P + N + L +A ++I++ + Sbjct: 284 HHIPFAAALHPKWTSYYYQHYSTDIPVQLSAYRFNEKWEENLYTLSQAEPDVIVS----M 339 Query: 357 DQLRLSPGELRAVAPIVEIPWM--EMGWKDHLRLIGQAIQRSERAEQWLADFEKEEAEAR 414 D +SP E + I E+ ++ E W+ H ++ AE+WLAD++++ A+ Sbjct: 340 D--SISPEEQDRLNRIAEVMYLPSEESWRTHFLQTASFLKEESEAEKWLADYDQQTTAAK 397 Query: 415 AIVQQSTGGKEIITILVIKPDGLLVYGSRNVGCVIYQSLGLRAPALIEAEMKKLGDQFHS 474 +Q G + L + + +R+V V + LG + + ++ Sbjct: 398 KTLQHVQGLR--FLFLRLHKQNFYLAHNRSVREVFFGDLGFSSATTADTPSEQ------- 448 Query: 475 FPIDISELAEYAGDRLLVVVFPDAKGSTAHTEAVFRSPHWKRLPAVQRKNVHWLERDEWV 534 I + +A Y D +++ +F + + + A+ + + ++ W+ L AV+ V+ L D W Sbjct: 449 -AISLENIANYQADCMMLFLFKEPE-TIAYYQQLQQTEAWQNLSAVRDNRVYLLSLDPWN 506 Query: 535 PYNPVSIRLQLGRAVAL 551 Y+ + + V+L Sbjct: 507 EYSACGHERIVQQTVSL 523 >ref|NP_347426.1| Ferrichrome-binding periplasmic proteinl, fhuD [Clostridium acetobutylicum] pir||C96997 ferrichrome-binding periplasmic proteinl, fhuD [imported] - Clostridium acetobutylicum gb|AAK78766.1| Ferrichrome-binding periplasmic proteinl, fhuD [Clostridium acetobutylicum] Length = 307 Score = 82.0 bits (201), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 58/217 (26%), Positives = 110/217 (50%), Gaps = 23/217 (10%) Query: 341 LLEANIELIIAAR--QHLDQLRLSPGELRAVAPIVEIPWMEMGWKDHLRLIGQAIQRSER 398 ++E +LIIA ++LD+L +AP V + ++G+ D + IG+ I + ++ Sbjct: 104 IIELKPDLIIAGSTDKNLDKLS-------KIAPTVSYTYNKLGYLDQVIEIGKLINKKKQ 156 Query: 399 AEQWLADFEKEEAEARAIVQQSTGGKEIITILVIKPDGLLVYGSRNVGC---VIYQSLGL 455 A++W+ +F+K ++A ++ G +TIL L V+GS N G ++YQ++GL Sbjct: 157 AQEWVNNFKKRASDAGEKIKNKIGNNSTVTILGGDNKQLYVFGS-NWGRGSEILYQAMGL 215 Query: 456 RAPALIEAEMKKLGDQFHSFPIDISELAEYAGDRLLVVVFPDAKGSTAHTEAVFRSPHWK 515 + PA + A K G + I L +Y GD L+ + A S +T+ +K Sbjct: 216 KMPAKVTANALKPG----YYVISSEVLPQYIGDYLIYIKDSAADNSFQNTDT------YK 265 Query: 516 RLPAVQRKNVHWLERDEWVPYNPVSIRLQLGRAVALF 552 +PAV+ V ++ +++ +P+S+ +L + F Sbjct: 266 NIPAVKNNRVLEVDANKFYFNDPISLDYELDTFINYF 302 >ref|NP_241717.1| transcriptional regulator (AraC/XylS family) [Bacillus halodurans] pir||C83756 transcription regulator (AraC/XylS family) BH0851 [imported] - Bacillus halodurans (strain C-125) dbj|BAB04570.1| transcriptional regulator (AraC/XylS family) [Bacillus halodurans] Length = 261 Score = 81.3 bits (199), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 39/97 (40%), Positives = 63/97 (64%) Query: 181 MERSITYLENHFSEKITREHLAAIAGVSRSHYSTLFKQLTGFTLNEYLSRLRVHRAKELL 240 M+ +I+Y+ NH E ++ H+A+ G S H+S LFK+ TG + Y+S LR+ +AKELL Sbjct: 8 MDVAISYIHNHLYEPLSLSHIASYVGYSSYHFSRLFKEKTGLSPLYYVSSLRLQKAKELL 67 Query: 241 LNSSGTLREIALKVGYKDEFYLSRRFKQETGTSPSGY 277 LN++ T+R+I L++G + + RF + G SPS + Sbjct: 68 LNTNLTVRDIGLEIGQQSLGTFTTRFTKCVGMSPSHF 104 >ref|NP_244709.1| two-component response regulator [Bacillus halodurans] pir||B84130 two-component response regulator BH3842 [imported] - Bacillus halodurans (strain C-125) dbj|BAB07561.1| two-component response regulator [Bacillus halodurans] Length = 530 Score = 81.3 bits (199), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 44/96 (45%), Positives = 62/96 (64%), Gaps = 1/96 (1%) Query: 187 YLENHFSEKITREHLAAIAGVSRSHYSTLFKQLTGFTLNEYLSRLRVHRAKELLLNSSGT 246 Y+ +HF E +T + LA G+S + S LFK+ T +EY+++LRV AK+LL + + Sbjct: 423 YVHDHFREPLTLDDLAKHIGLSPYYVSKLFKERFDLTFSEYVTQLRVEHAKQLLSLTQKS 482 Query: 247 LREIALKVGYKDEFYLSRRFKQETGTSPSGYNRKPI 282 L+EI ++GYKD Y SR FK+ TG SPS Y RK I Sbjct: 483 LKEITYEIGYKDPNYFSRVFKKLTGKSPSDY-RKSI 517 >ref|ZP_00180754.1| hypothetical protein Mther123301 [Moorella thermoacetica ATCC 39073] Length = 439 Score = 80.1 bits (196), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 37/99 (37%), Positives = 64/99 (64%) Query: 181 MERSITYLENHFSEKITREHLAAIAGVSRSHYSTLFKQLTGFTLNEYLSRLRVHRAKELL 240 ++R+ Y+E +FS+ +T E +A +S ++S LFKQ G +YL+++R+ A+ELL Sbjct: 330 IDRASKYIEANFSQDLTLEEVARQVYLSPCYFSKLFKQFKGLNFIDYLTKVRLKAARELL 389 Query: 241 LNSSGTLREIALKVGYKDEFYLSRRFKQETGTSPSGYNR 279 LN+ + EIA +VGY+D Y + FK++ G +PS + + Sbjct: 390 LNTKLPVAEIATRVGYRDARYFGQVFKKQEGYTPSVFRK 428 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 775,552,879 Number of extensions: 30512903 Number of successful extensions: 83203 Number of sequences better than 1.0e-05: 492 Number of HSP's gapped: 83261 Number of HSP's successfully gapped: 492 Length of query: 555 Length of database: 757,237,578 Length adjustment: 131 Effective length of query: 424 Effective length of database: 401,559,609 Effective search space: 170261274216 Effective search space used: 170261274216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 129 (54.3 bits)