BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0033.0006.p (119 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_390890.1| similar to hypothetical proteins [Bacillus subt... 132 4e-30 ref|NP_241351.1| BH0485~unknown conserved protein [Bacillus halo... 129 2e-29 ref|NP_693007.1| hypothetical protein OB2086 [Oceanobacillus ihe... 125 4e-28 ref|ZP_00036086.1| COG4225: Predicted unsaturated glucuronyl hyd... 61 1e-08 ref|NP_346999.1| Similar to yteR (Bacilus subtilis) [Clostridium... 54 1e-06 >ref|NP_390890.1| similar to hypothetical proteins [Bacillus subtilis] pir||A69991 probable di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) yteR - Bacillus subtilis pdb|1NC5|A Chain A, Structure Of Hypothetical Protein Of Yter From Bacillus Subtilis gb|AAC00272.1| yteR [Bacillus subtilis] emb|CAB14990.1| yteR [Bacillus subtilis subsp. subtilis str. 168] Length = 373 Score = 132 bits (331), Expect = 4e-30, Method: Compositional matrix adjust. Identities = 60/101 (59%), Positives = 79/101 (78%) Query: 10 TPIEWAKQACDSLMDTYTAGELPPAHRWHYHQGVFLCGMEILWEAVREERYIEYIQQYVD 69 +P+ +A+ +++M+TYT ELPPA+RWHYHQGVFLCG+ LWEA E+RY EY + Y D Sbjct: 12 SPLTYAEALANTIMNTYTVEELPPANRWHYHQGVFLCGVLRLWEATGEKRYFEYAKAYAD 71 Query: 70 DLVDENGNLYFARDELDAIQAGLLLFTLHKRTGKEKYRIAA 110 L+D+NGNL F RDELDAIQAGL+LF L+++T E+Y AA Sbjct: 72 LLIDDNGNLLFRRDELDAIQAGLILFPLYEQTKDERYVKAA 112 >ref|NP_241351.1| BH0485~unknown conserved protein [Bacillus halodurans] pir||E83710 hypothetical protein BH0485 [imported] - Bacillus halodurans (strain C-125) dbj|BAB04204.1| BH0485~unknown conserved protein [Bacillus halodurans] Length = 365 Score = 129 bits (325), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 59/107 (55%), Positives = 78/107 (72%) Query: 4 IGSLPATPIEWAKQACDSLMDTYTAGELPPAHRWHYHQGVFLCGMEILWEAVREERYIEY 63 + +L + A+QAC ++M Y ELPP +RWHYHQGVFL GM +WEA ++E Y+ Y Sbjct: 1 MSTLSVATMAVAEQACQTMMKRYEPLELPPKNRWHYHQGVFLYGMYRVWEATKKEEYLSY 60 Query: 64 IQQYVDDLVDENGNLYFARDELDAIQAGLLLFTLHKRTGKEKYRIAA 110 + YVD L+DE+GN YFARDELDAIQAGLLLF L+++T +Y +AA Sbjct: 61 TKGYVDGLIDEHGNFYFARDELDAIQAGLLLFPLYEKTKDSRYEVAA 107 >ref|NP_693007.1| hypothetical protein OB2086 [Oceanobacillus iheyensis HTE831] dbj|BAC14042.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 368 Score = 125 bits (313), Expect = 4e-28, Method: Composition-based stats. Identities = 53/100 (53%), Positives = 74/100 (74%) Query: 11 PIEWAKQACDSLMDTYTAGELPPAHRWHYHQGVFLCGMEILWEAVREERYIEYIQQYVDD 70 P+ WA++AC S+M+ +T +LPP +RWHYHQGVFL GM +++ + Y Y++ YVD+ Sbjct: 12 PLTWAEKACKSMMNQFTPSQLPPQNRWHYHQGVFLSGMLEVFKETQGNEYYNYVKAYVDN 71 Query: 71 LVDENGNLYFARDELDAIQAGLLLFTLHKRTGKEKYRIAA 110 L+DE GN FAR ELDAIQ GLLL L+K TG ++Y+IA+ Sbjct: 72 LIDEEGNFLFARSELDAIQPGLLLLYLYKHTGDKRYKIAS 111 >ref|ZP_00036086.1| COG4225: Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins [Enterococcus faecium] Length = 367 Score = 60.8 bits (146), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 35/102 (34%), Positives = 58/102 (56%), Gaps = 5/102 (4%) Query: 14 WAKQACDSLMDTYTA--GELPPAHRWHYHQGVFLCGMEILWEAVREERYIEYIQQYVDDL 71 W+K+ S+M+ E +W Y GV L G ++LWE +E+ Y ++I+ +D Sbjct: 4 WSKKLAKSIMERTPRLYEEKWYKGKWSYDYGVVLKGFQLLWERTQEKIYFDFIKDNIDYF 63 Query: 72 VDENGNLY-FARDE--LDAIQAGLLLFTLHKRTGKEKYRIAA 110 V E+G + ++ +E +D + G L F L+K TG+EKY+ AA Sbjct: 64 VQEDGTIRGYSVEEYNIDHVNTGKLFFLLYKETGEEKYKKAA 105 >ref|NP_346999.1| Similar to yteR (Bacilus subtilis) [Clostridium acetobutylicum] pir||H96943 similar to yteR (Bacilus subtilis) [imported] - Clostridium acetobutylicum gb|AAK78339.1| Similar to yteR (Bacilus subtilis) [Clostridium acetobutylicum] Length = 361 Score = 53.5 bits (127), Expect = 1e-06, Method: Composition-based stats. Identities = 28/91 (30%), Positives = 52/91 (57%), Gaps = 3/91 (3%) Query: 22 LMDTYTAGELPPAHRWHYHQGVFLCGMEILWEAVREERYIEYIQQYVDDLVDENGNLYFA 81 + D+ A + W Y G+ L G+ ++E ++++Y+++I + +D ++E+G + Sbjct: 8 MADSIIAKNITLTDHWGYEYGLTLDGIAKVYEWTKDKKYLDFIIKTMDTFINEDGTINGY 67 Query: 82 RDE---LDAIQAGLLLFTLHKRTGKEKYRIA 109 + E +D + G +L TL K TGKEKYR A Sbjct: 68 KLEEYNIDHLNNGKILITLFKETGKEKYRKA 98 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.324 0.139 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 182,061,767 Number of extensions: 6881440 Number of successful extensions: 35252 Number of sequences better than 1.0e-05: 8 Number of HSP's gapped: 35255 Number of HSP's successfully gapped: 8 Length of query: 119 Length of database: 757,237,578 Length adjustment: 84 Effective length of query: 35 Effective length of database: 529,169,262 Effective search space: 18520924170 Effective search space used: 18520924170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 120 (50.8 bits)