BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0027.0011.p (69 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_466311.1| lmo2789 [Listeria monocytogenes EGD-e] >gi|2551... 92 3e-18 ref|NP_472248.1| similar to unknown protein [Listeria innocua] >... 92 4e-18 ref|NP_694403.1| hypothetical protein OB3481 [Oceanobacillus ihe... 86 4e-16 ref|NP_653943.1| hypothetical protein predicted by GeneMark [Bac... 85 5e-16 ref|NP_244920.1| BH4052~unknown conserved protein in others [Bac... 84 1e-15 >ref|NP_466311.1| lmo2789 [Listeria monocytogenes EGD-e] pir||AD1423 hypothetical protein lmo2789 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAD01002.1| lmo2789 [Listeria monocytogenes] Length = 68 Score = 92.4 bits (228), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 44/66 (66%), Positives = 52/66 (78%) Query: 1 MERKIFGLGDIVLMKKPHPCGTNEMEIIRMGMDIRIKCTGCHHSVLIPRAKFEKNMKKVL 60 ME+K F L D+V MKKPHPCGTN +IIRMGMDIRIKC GC HSV+IPR +FE+ +KK+L Sbjct: 3 MEKKHFDLNDVVEMKKPHPCGTNRFKIIRMGMDIRIKCEGCGHSVMIPRREFERKVKKIL 62 Query: 61 RSAGGE 66 A E Sbjct: 63 VKAEQE 68 >ref|NP_472248.1| similar to unknown protein [Listeria innocua] pir||AB1797 hypothetical protein homolog lin2921 [imported] - Listeria innocua (strain Clip11262) emb|CAC98146.1| lin2921 [Listeria innocua] Length = 65 Score = 92.0 bits (227), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 44/63 (69%), Positives = 51/63 (80%) Query: 1 MERKIFGLGDIVLMKKPHPCGTNEMEIIRMGMDIRIKCTGCHHSVLIPRAKFEKNMKKVL 60 ME+K F L DIV MKKPHPCGTN +IIRMGMDIRIKC GC HSV+IPR +FE+ +KK+L Sbjct: 1 MEKKHFDLNDIVEMKKPHPCGTNRFKIIRMGMDIRIKCEGCGHSVMIPRREFERKVKKIL 60 Query: 61 RSA 63 A Sbjct: 61 VKA 63 >ref|NP_694403.1| hypothetical protein OB3481 [Oceanobacillus iheyensis HTE831] dbj|BAC15437.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 67 Score = 85.5 bits (210), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 44/69 (63%), Positives = 47/69 (68%), Gaps = 2/69 (2%) Query: 1 MERKIFGLGDIVLMKKPHPCGTNEMEIIRMGMDIRIKCTGCHHSVLIPRAKFEKNMKKVL 60 M K FGL D+V MKK HPCG N +IIRMGMDIRIKC C HSV+IPR F K MKKVL Sbjct: 1 MMDKEFGLNDVVQMKKAHPCGENRWKIIRMGMDIRIKCLRCQHSVMIPRRDFTKKMKKVL 60 Query: 61 RSAGGENHE 69 G N E Sbjct: 61 EK--GNNQE 67 >ref|NP_653943.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_847871.1| conserved hypothetical protein [Bacillus anthracis str. Ames] ref|NP_981919.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAP29357.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAS44527.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 65 Score = 85.1 bits (209), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 38/60 (63%), Positives = 48/60 (80%) Query: 1 MERKIFGLGDIVLMKKPHPCGTNEMEIIRMGMDIRIKCTGCHHSVLIPRAKFEKNMKKVL 60 ME+K + L D+V MKK HPCG N +IIRMGMDIRIKC GC HSV+IPR +F++ +KK+L Sbjct: 1 MEQKQYNLYDVVEMKKAHPCGENRWKIIRMGMDIRIKCEGCDHSVMIPRREFDRKVKKIL 60 >ref|NP_244920.1| BH4052~unknown conserved protein in others [Bacillus halodurans] pir||D84156 hypothetical protein BH4052 [imported] - Bacillus halodurans (strain C-125) dbj|BAB07771.1| BH4052~unknown conserved protein in others [Bacillus halodurans] Length = 65 Score = 83.6 bits (205), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 39/61 (63%), Positives = 46/61 (75%) Query: 4 KIFGLGDIVLMKKPHPCGTNEMEIIRMGMDIRIKCTGCHHSVLIPRAKFEKNMKKVLRSA 63 K F L D+V MKKPHPCG N +IIRMGMDIR+KC GC HSVL+PR +F K +K+VL A Sbjct: 3 KEFDLHDVVEMKKPHPCGENRWKIIRMGMDIRMKCLGCGHSVLLPRKEFTKKLKRVLERA 62 Query: 64 G 64 Sbjct: 63 S 63 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.324 0.141 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 101,301,123 Number of extensions: 2988669 Number of successful extensions: 4882 Number of sequences better than 1.0e-05: 23 Number of HSP's gapped: 4876 Number of HSP's successfully gapped: 23 Length of query: 69 Length of database: 757,237,578 Length adjustment: 40 Effective length of query: 29 Effective length of database: 648,633,618 Effective search space: 18810374922 Effective search space used: 18810374922 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 120 (50.8 bits)