BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0027.0009.p (97 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00180391.1| hypothetical protein Mther164301 [Moorella th... 114 9e-25 ref|NP_391971.1| ribosomal protein S6 (BS9) [Bacillus subtilis] ... 105 2e-22 ref|NP_244918.1| 30S ribosomal protein S6; ribosomal protein S6 ... 104 7e-22 ref|NP_694401.1| 30S ribosomal protein S6 [Oceanobacillus iheyen... 104 7e-22 ref|NP_350304.1| Ribosomal protein S6 [Clostridium acetobutylicu... 97 1e-19 >ref|ZP_00180391.1| hypothetical protein Mther164301 [Moorella thermoacetica ATCC 39073] Length = 98 Score = 114 bits (284), Expect = 9e-25, Method: Compositional matrix adjust. Identities = 53/91 (58%), Positives = 73/91 (80%), Gaps = 1/91 (1%) Query: 4 MRKYEVMYIIRPDIEQEAVQAAVEKFQGIISN-GGEITKHEVQGKRRLAYEIKKFRDGVY 62 MR YEV+++IRPD+E EA A VEKF +I++ GG++T+ + GK+R+AYE++K+R+G Y Sbjct: 1 MRNYEVVFVIRPDLEAEATTAVVEKFTQLITDQGGQVTRVDQWGKKRMAYEVRKYREGYY 60 Query: 63 VLVNFTAEPAVVTELERIMKISDEVIRYLIT 93 VLV F PAV ELER++KISD+VIRYLIT Sbjct: 61 VLVEFKGTPAVAQELERVLKISDDVIRYLIT 91 >ref|NP_391971.1| ribosomal protein S6 (BS9) [Bacillus subtilis] sp|P21468|RS6_BACSU 30S ribosomal protein S6 (BS9) pir||S66015 ribosomal protein S6 (BS9) rpsF - Bacillus subtilis dbj|BAA05221.1| ribosomal protein S6 [Bacillus subtilis] emb|CAB16128.1| ribosomal protein S6 (BS9) [Bacillus subtilis subsp. subtilis str. 168] Length = 95 Score = 105 bits (263), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 49/90 (54%), Positives = 69/90 (76%), Gaps = 1/90 (1%) Query: 4 MRKYEVMYIIRPDIEQEAVQAAVEKFQGII-SNGGEITKHEVQGKRRLAYEIKKFRDGVY 62 MRKYEVMYIIRP+I++E+ +A +E+F ++ SNG EIT + GKRRLAYEI FRDG Y Sbjct: 1 MRKYEVMYIIRPNIDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFY 60 Query: 63 VLVNFTAEPAVVTELERIMKISDEVIRYLI 92 +VN ++ A V E +R+ KISD++IR+++ Sbjct: 61 QIVNVQSDAAAVQEFDRLAKISDDIIRHIV 90 >ref|NP_244918.1| 30S ribosomal protein S6; ribosomal protein S6 (BS9) [Bacillus halodurans] sp|Q9K5N8|RS6_BACHD 30S ribosomal protein S6 pir||B84156 ribosomal protein S6 (BS9) rpsF [imported] - Bacillus halodurans (strain C-125) dbj|BAB07769.1| 30S ribosomal protein S6 [Bacillus halodurans] Length = 95 Score = 104 bits (259), Expect = 7e-22, Method: Compositional matrix adjust. Identities = 51/93 (54%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Query: 4 MRKYEVMYIIRPDIEQEAVQAAVEKFQGIISN-GGEITKHEVQGKRRLAYEIKKFRDGVY 62 MRKYE+MYII P++E+ A + +E+F G+++N G EI K E GKRRLAYEI KFR+G Y Sbjct: 1 MRKYEIMYIIAPNLEEAANKEIIERFNGVLTNQGAEIEKVEEMGKRRLAYEINKFREGYY 60 Query: 63 VLVNFTAEPAVVTELERIMKISDEVIRYLITND 95 VL+N A+ + E R++KI+D VIR LIT D Sbjct: 61 VLLNVKADADAIAEFNRLIKINDNVIRVLITKD 93 >ref|NP_694401.1| 30S ribosomal protein S6 [Oceanobacillus iheyensis HTE831] sp|Q8EKV4|RS6_OCEIH 30S ribosomal protein S6 dbj|BAC15435.1| 30S ribosomal protein S6 [Oceanobacillus iheyensis HTE831] Length = 95 Score = 104 bits (259), Expect = 7e-22, Method: Compositional matrix adjust. Identities = 48/93 (51%), Positives = 67/93 (72%), Gaps = 1/93 (1%) Query: 4 MRKYEVMYIIRPDIEQEAVQAAVEKFQGIIS-NGGEITKHEVQGKRRLAYEIKKFRDGVY 62 MRKYE+MYIIRPDIE+EA A +E+F I++ NG EI K + +GKRRLAYEI +RDG Y Sbjct: 1 MRKYEIMYIIRPDIEEEAQTALIERFNTILTDNGAEIDKVDEKGKRRLAYEINDYRDGYY 60 Query: 63 VLVNFTAEPAVVTELERIMKISDEVIRYLITND 95 V++NF + E +R+ K +D++IR++ D Sbjct: 61 VIINFRGSEEAINEFDRLAKFNDDIIRHMAIKD 93 >ref|NP_350304.1| Ribosomal protein S6 [Clostridium acetobutylicum] sp|Q97CX2|RS6_CLOAB 30S ribosomal protein S6 pir||A97357 ribosomal protein S6 [imported] - Clostridium acetobutylicum gb|AAK81644.1| Ribosomal protein S6 [Clostridium acetobutylicum] Length = 95 Score = 97.1 bits (240), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 42/90 (46%), Positives = 66/90 (73%), Gaps = 1/90 (1%) Query: 4 MRKYEVMYIIRPDIEQEAVQAAVEKFQGIISNGG-EITKHEVQGKRRLAYEIKKFRDGVY 62 M KYE ++I+ P +++E + VEKF+ +I+NGG E+ ++ GKR+LAYEI K +G+Y Sbjct: 1 MNKYETLFILNPSLDEEGINTNVEKFKSVITNGGGEVENVDLWGKRKLAYEIDKVNEGIY 60 Query: 63 VLVNFTAEPAVVTELERIMKISDEVIRYLI 92 VLVNF ++ + EL+R+ +ISD +IR+LI Sbjct: 61 VLVNFQSDAQLPKELDRVFRISDSIIRHLI 90 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.321 0.138 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 128,808,664 Number of extensions: 4448020 Number of successful extensions: 13625 Number of sequences better than 1.0e-05: 321 Number of HSP's gapped: 13507 Number of HSP's successfully gapped: 321 Length of query: 97 Length of database: 757,237,578 Length adjustment: 65 Effective length of query: 32 Effective length of database: 580,756,143 Effective search space: 18584196576 Effective search space used: 18584196576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 120 (50.8 bits)