BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0027.0007.p (90 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_244916.1| 30S ribosomal protein S18; ribosomal protein S1... 122 2e-27 ref|NP_835127.1| SSU ribosomal protein S18P [Bacillus cereus ATC... 122 3e-27 ref|NP_653939.1| Ribosomal_S18, Ribosomal protein S18 [Bacillus ... 121 4e-27 ref|NP_469386.1| ribosomal protein S18 [Listeria innocua] >gi|16... 119 2e-26 ref|NP_370891.1| 30S ribosomal protein S18 [Staphylococcus aureu... 118 4e-26 >ref|NP_244916.1| 30S ribosomal protein S18; ribosomal protein S18 [Bacillus halodurans] sp|Q9K5P0|RS18_BACHD 30S ribosomal protein S18 pir||H84155 ribosomal protein S18 rpsR [imported] - Bacillus halodurans (strain C-125) dbj|BAB07767.1| 30S ribosomal protein S18 [Bacillus halodurans] Length = 77 Score = 122 bits (307), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 59/73 (80%), Positives = 65/73 (89%) Query: 18 RGGRNKRKKVCYFTVNKITHIDYKDTELLKKFISERGKILPRRVTGTSAKYQRALTIAVK 77 R GR KR+KVCYFTVNKI IDYKD +LLKKF+SERGKILPRRVTGTSAKYQR LT A+K Sbjct: 3 RRGRPKRRKVCYFTVNKIEKIDYKDVDLLKKFVSERGKILPRRVTGTSAKYQRQLTTAIK 62 Query: 78 RSRQIALLPYTTE 90 R+RQIALLPY T+ Sbjct: 63 RARQIALLPYVTD 75 >ref|NP_835127.1| SSU ribosomal protein S18P [Bacillus cereus ATCC 14579] ref|NP_981915.1| ribosomal protein S18 [Bacillus cereus ATCC 10987] gb|AAP12328.1| SSU ribosomal protein S18P [Bacillus cereus ATCC 14579] gb|AAS44523.1| ribosomal protein S18 [Bacillus cereus ATCC 10987] Length = 77 Score = 122 bits (306), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 56/75 (74%), Positives = 66/75 (88%) Query: 16 ARRGGRNKRKKVCYFTVNKITHIDYKDTELLKKFISERGKILPRRVTGTSAKYQRALTIA 75 R+GGR KR+KVC+FT N IT IDYKD +LLK+F+SERGKILPRRVTGTSAKYQR LT+A Sbjct: 3 GRKGGRAKRRKVCFFTANGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVA 62 Query: 76 VKRSRQIALLPYTTE 90 +KR+RQ+ALLPY E Sbjct: 63 IKRARQMALLPYVGE 77 >ref|NP_653939.1| Ribosomal_S18, Ribosomal protein S18 [Bacillus anthracis A2012] ref|NP_847867.1| ribosomal protein S18 [Bacillus anthracis str. Ames] gb|AAP29353.1| ribosomal protein S18 [Bacillus anthracis str. Ames] Length = 77 Score = 121 bits (304), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 56/75 (74%), Positives = 66/75 (88%) Query: 16 ARRGGRNKRKKVCYFTVNKITHIDYKDTELLKKFISERGKILPRRVTGTSAKYQRALTIA 75 R+GGR KR+KVC+FT N IT IDYKD +LLK+F+SERGKILPRRVTGTSAKYQR LT+A Sbjct: 3 GRKGGRAKRRKVCFFTSNGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVA 62 Query: 76 VKRSRQIALLPYTTE 90 +KR+RQ+ALLPY E Sbjct: 63 IKRARQMALLPYVGE 77 >ref|NP_469386.1| ribosomal protein S18 [Listeria innocua] ref|NP_463579.1| ribosomal protein S18 [Listeria monocytogenes EGD-e] sp|Q92FR4|RS18_LISMO 30S ribosomal protein S18 pir||AG1080 ribosomal protein S18 [imported] - Listeria monocytogenes (strain EGD-e) pir||AH1437 ribosomal protein S18 [imported] - Listeria innocua (strain Clip11262) emb|CAC98261.1| ribosomal protein S18 [Listeria monocytogenes] emb|CAC95272.1| ribosomal protein S18 [Listeria innocua] Length = 79 Score = 119 bits (298), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 55/66 (83%), Positives = 60/66 (90%) Query: 25 KKVCYFTVNKITHIDYKDTELLKKFISERGKILPRRVTGTSAKYQRALTIAVKRSRQIAL 84 KKVCYFT N ITHIDYKD ELLKKF+SERGKILPRRVTGTSAKYQR LT+A+KRSRQ+AL Sbjct: 12 KKVCYFTSNGITHIDYKDVELLKKFVSERGKILPRRVTGTSAKYQRKLTVAIKRSRQMAL 71 Query: 85 LPYTTE 90 LP+ E Sbjct: 72 LPFVAE 77 >ref|NP_370891.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus Mu50] ref|NP_373601.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus N315] ref|NP_645160.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus MW2] sp|Q99WL0|RS18_STAAM 30S ribosomal protein S18 pir||H89802 30S ribosomal protein S18 [imported] - Staphylococcus aureus (strain N315) dbj|BAB41579.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus N315] dbj|BAB56529.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB94208.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus MW2] Length = 80 Score = 118 bits (295), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 56/66 (84%), Positives = 59/66 (89%) Query: 25 KKVCYFTVNKITHIDYKDTELLKKFISERGKILPRRVTGTSAKYQRALTIAVKRSRQIAL 84 KKVCYFT N ITHIDYKDTELLK+FISERGKILPRRVTGTSAKYQR LT A+KRSR +AL Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRSRHMAL 72 Query: 85 LPYTTE 90 LPY E Sbjct: 73 LPYVKE 78 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.320 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 127,496,654 Number of extensions: 4339495 Number of successful extensions: 11524 Number of sequences better than 1.0e-05: 464 Number of HSP's gapped: 11528 Number of HSP's successfully gapped: 464 Length of query: 90 Length of database: 757,237,578 Length adjustment: 59 Effective length of query: 31 Effective length of database: 597,046,737 Effective search space: 18508448847 Effective search space used: 18508448847 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 120 (50.8 bits)