BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0022.0002.p (102 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_834679.1| hypothetical Cytosolic Protein [Bacillus cereus... 114 9e-25 ref|NP_653478.1| DUF77, Protein of unknown function DUF77 [Bacil... 113 1e-24 ref|NP_981443.1| conserved hypothetical protein TIGR00106 [Bacil... 111 7e-24 ref|NP_349390.1| Uncharacterized conserved protein, YQGV B.subti... 107 7e-23 ref|ZP_00180485.1| hypothetical protein Mther157801 [Moorella th... 107 8e-23 >ref|NP_834679.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579] gb|AAP11880.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579] Length = 100 Score = 114 bits (284), Expect = 9e-25, Method: Compositional matrix adjust. Identities = 55/100 (55%), Positives = 75/100 (75%), Gaps = 1/100 (1%) Query: 1 MAIGEVTVIPIGTGSTSLSSYVADMQRVLE-TVEGITYELTSMGTIIEGPLARILAAVEA 59 MAI +V++IP+GTG+ S+S YVA++Q+VLE + + Y+LT M TIIEG L IL ++ Sbjct: 1 MAIVDVSIIPVGTGNPSVSEYVAEVQKVLEKNADRVKYQLTPMNTIIEGDLPVILEVIQQ 60 Query: 60 LHESPFTAGAQRVSTSLKIDDRRDKPSTSRSKLESVERKL 99 +HE P+T GAQRV+T+++IDDRRDK ST KL SV KL Sbjct: 61 MHEVPYTKGAQRVATTIRIDDRRDKVSTMEKKLNSVRSKL 100 >ref|NP_653478.1| DUF77, Protein of unknown function DUF77 [Bacillus anthracis A2012] ref|NP_847434.1| conserved hypothetical protein TIGR00106 [Bacillus anthracis str. Ames] gb|AAP28920.1| conserved hypothetical protein TIGR00106 [Bacillus anthracis str. Ames] Length = 100 Score = 113 bits (282), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 54/100 (54%), Positives = 75/100 (75%), Gaps = 1/100 (1%) Query: 1 MAIGEVTVIPIGTGSTSLSSYVADMQRVLE-TVEGITYELTSMGTIIEGPLARILAAVEA 59 MAI +V++IP+GTG+ S+S YVA++Q+VLE + + Y+LT M T+IEG L IL ++ Sbjct: 1 MAIVDVSIIPVGTGNPSVSEYVAEVQKVLEKNADRVKYQLTPMNTVIEGDLPVILEVIQQ 60 Query: 60 LHESPFTAGAQRVSTSLKIDDRRDKPSTSRSKLESVERKL 99 +HE P+T GAQRV+T+++IDDRRDK ST KL SV KL Sbjct: 61 MHEVPYTKGAQRVATTIRIDDRRDKVSTMEKKLNSVRSKL 100 >ref|NP_981443.1| conserved hypothetical protein TIGR00106 [Bacillus cereus ATCC 10987] gb|AAS44051.1| conserved hypothetical protein TIGR00106 [Bacillus cereus ATCC 10987] Length = 100 Score = 111 bits (277), Expect = 7e-24, Method: Compositional matrix adjust. Identities = 54/100 (54%), Positives = 74/100 (74%), Gaps = 1/100 (1%) Query: 1 MAIGEVTVIPIGTGSTSLSSYVADMQRVLE-TVEGITYELTSMGTIIEGPLARILAAVEA 59 MAI +V++IP+GT + S+S YVA++Q+VLE + + Y+LT M TIIEG L IL ++ Sbjct: 1 MAIVDVSIIPVGTSNPSVSEYVAEVQKVLEKNSDRVKYQLTPMNTIIEGDLPVILEVIQQ 60 Query: 60 LHESPFTAGAQRVSTSLKIDDRRDKPSTSRSKLESVERKL 99 +HE P+T GAQRV+T+++IDDRRDK ST KL SV KL Sbjct: 61 MHEVPYTKGAQRVATTIRIDDRRDKVSTMEKKLNSVRSKL 100 >ref|NP_349390.1| Uncharacterized conserved protein, YQGV B.subtilis ortholog [Clostridium acetobutylicum] pir||G97242 uncharacterized conserved protein, YQGV B. subtilis ortholog CAC2786 [imported] - Clostridium acetobutylicum gb|AAK80730.1| Uncharacterized conserved protein, YQGV B.subtilis ortholog [Clostridium acetobutylicum] Length = 100 Score = 107 bits (268), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 52/100 (52%), Positives = 69/100 (69%) Query: 1 MAIGEVTVIPIGTGSTSLSSYVADMQRVLETVEGITYELTSMGTIIEGPLARILAAVEAL 60 MAI + T+IP+GTGSTSLSSYVA + +L+ + I Y+LT M TI EG + I+ + + Sbjct: 1 MAIAQATIIPVGTGSTSLSSYVAACENILKAEKEIKYKLTPMCTIFEGEIDTIIRVIRKM 60 Query: 61 HESPFTAGAQRVSTSLKIDDRRDKPSTSRSKLESVERKLQ 100 HE PF GA+RV TS+ IDDRRDK ++ KL SV KL+ Sbjct: 61 HEIPFENGAERVITSISIDDRRDKKASMEQKLNSVREKLK 100 >ref|ZP_00180485.1| hypothetical protein Mther157801 [Moorella thermoacetica ATCC 39073] Length = 104 Score = 107 bits (267), Expect = 8e-23, Method: Compositional matrix adjust. Identities = 55/99 (55%), Positives = 69/99 (69%) Query: 1 MAIGEVTVIPIGTGSTSLSSYVADMQRVLETVEGITYELTSMGTIIEGPLARILAAVEAL 60 MAI EV + P+GTGSTS+S YVAD+ +VL+ GI Y+LT MGTIIEG + ++ L Sbjct: 1 MAILEVVIAPLGTGSTSISPYVADVHKVLKETSGIKYQLTPMGTIIEGEPDVLFPLLQRL 60 Query: 61 HESPFTAGAQRVSTSLKIDDRRDKPSTSRSKLESVERKL 99 HE PF GA+R T ++IDDRRDK T KL+SVE KL Sbjct: 61 HEVPFARGARRSMTIIRIDDRRDKELTMEGKLKSVEEKL 99 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.311 0.127 0.330 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 117,028,084 Number of extensions: 3521528 Number of successful extensions: 9484 Number of sequences better than 1.0e-05: 46 Number of HSP's gapped: 9464 Number of HSP's successfully gapped: 46 Length of query: 102 Length of database: 757,237,578 Length adjustment: 69 Effective length of query: 33 Effective length of database: 569,895,747 Effective search space: 18806559651 Effective search space used: 18806559651 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 120 (50.8 bits)