BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0019.0020.p (157 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_348563.1| Transcription regulator AbrB [Clostridium aceto... 75 5e-13 ref|NP_621806.1| transcription regulator AbrB [Thermoanaerobacte... 73 3e-12 ref|NP_350231.1| Possible stage V sporulation protein T, transcr... 71 7e-12 ref|NP_346951.1| Regulators of stationary/sporulation gene expre... 70 2e-11 ref|ZP_00098851.1| COG2002: Regulators of stationary/sporulation... 69 3e-11 >ref|NP_348563.1| Transcription regulator AbrB [Clostridium acetobutylicum] pir||D97139 transcription regulator AbrB [imported] - Clostridium acetobutylicum gb|AAK79903.1| Transcription regulator AbrB [Clostridium acetobutylicum] Length = 79 Score = 75.1 bits (183), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 40/79 (50%), Positives = 50/79 (63%), Gaps = 2/79 (2%) Query: 1 MKDTGMIRSLDSLGRIVVPVEIRMTRNIDIGDPIEFFILDEEIIVLRKYTSTECTFCRSL 60 MK TG++R LDSLGR+V+P E+R T NI D +E ++ D E IVL+KY C FC Sbjct: 1 MKSTGIVRKLDSLGRVVIPKELRRTFNIAEKDALEIYV-DGEQIVLKKYNPA-CVFCGEA 58 Query: 61 DHVSYYKDQFICNSCLKEL 79 V YK + IC CLKEL Sbjct: 59 SDVINYKGKKICKKCLKEL 77 >ref|NP_621806.1| transcription regulator AbrB [Thermoanaerobacter tengcongensis] gb|AAM23410.1| transcription regulator AbrB [Thermoanaerobacter tengcongensis] Length = 84 Score = 72.8 bits (177), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 36/79 (45%), Positives = 54/79 (68%), Gaps = 2/79 (2%) Query: 1 MKDTGMIRSLDSLGRIVVPVEIRMTRNIDIGDPIEFFILDEEIIVLRKYTSTECTFCRSL 60 +K TG++R +D LGR+V+P+E+R T NI D +E ++ D E IVL+KY C FC + Sbjct: 2 LKSTGIVRKVDELGRVVIPIELRRTLNIAERDALEIYV-DGEQIVLKKYEPA-CIFCGNA 59 Query: 61 DHVSYYKDQFICNSCLKEL 79 ++V YK + IC +CL+EL Sbjct: 60 ENVINYKGKNICKNCLEEL 78 >ref|NP_350231.1| Possible stage V sporulation protein T, transcriptional regulator AbrB homolog [Clostridium acetobutylicum] pir||H97347 probable stage V sporulation protein T, transcription regulator AbrB homolog [imported] - Clostridium acetobutylicum gb|AAK81571.1| Possible stage V sporulation protein T, transcriptional regulator AbrB homolog [Clostridium acetobutylicum] Length = 84 Score = 71.2 bits (173), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 37/80 (46%), Positives = 51/80 (63%), Gaps = 2/80 (2%) Query: 1 MKDTGMIRSLDSLGRIVVPVEIRMTRNIDIGDPIEFFILD-EEIIVLRKYTSTECTFCRS 59 M G++R +D LGRIV+P E R N++ GD +E FI + E IVLRKY + CTFC S Sbjct: 1 MNSIGIVRKVDELGRIVIPKETRSQLNVNEGDSLEIFIDEVESHIVLRKY-APGCTFCNS 59 Query: 60 LDHVSYYKDQFICNSCLKEL 79 L ++Y+K +C C +EL Sbjct: 60 LSDITYFKGVRVCKHCKEEL 79 >ref|NP_346951.1| Regulators of stationary/sporulation gene expression, abrB B.subtilis ortholog [Clostridium acetobutylicum] pir||H96937 regulators of stationary/sporulation gene expression, abrB B. subtilis ortholog [imported] - Clostridium acetobutylicum gb|AAK78291.1| Regulators of stationary/sporulation gene expression, abrB B.subtilis ortholog [Clostridium acetobutylicum] Length = 81 Score = 69.7 bits (169), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 36/79 (45%), Positives = 50/79 (63%), Gaps = 2/79 (2%) Query: 1 MKDTGMIRSLDSLGRIVVPVEIRMTRNIDIGDPIEFFILDEEIIVLRKYTSTECTFCRSL 60 MK TG++R +D LGRIV+P+E+R T NI D +E ++ D E I+L+KY C FC Sbjct: 1 MKSTGVVRRVDELGRIVIPIELRRTLNIAEKDALEIYV-DGEQIILKKYEPA-CIFCGDA 58 Query: 61 DHVSYYKDQFICNSCLKEL 79 V Y+ + IC CL+EL Sbjct: 59 SDVINYRGKNICKHCLEEL 77 >ref|ZP_00098851.1| COG2002: Regulators of stationary/sporulation gene expression [Desulfitobacterium hafniense] Length = 90 Score = 69.3 bits (168), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 31/80 (38%), Positives = 50/80 (62%), Gaps = 2/80 (2%) Query: 1 MKDTGMIRSLDSLGRIVVPVEIRMTRNIDIGDPIEFFILDEEIIVLRKYTSTECTFCRSL 60 MK TG++R +D LGR+V+P+E+R T ID D +E ++ D+E I+L+KY C FC + Sbjct: 2 MKSTGIVRKVDELGRVVLPIELRRTLGIDEKDALEIYV-DQEKIILKKYEPA-CVFCNNA 59 Query: 61 DHVSYYKDQFICNSCLKELG 80 V ++ + +C C +G Sbjct: 60 TDVQIFRGKNVCRECATAMG 79 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 220,952,927 Number of extensions: 8620407 Number of successful extensions: 27738 Number of sequences better than 1.0e-05: 37 Number of HSP's gapped: 27735 Number of HSP's successfully gapped: 37 Length of query: 157 Length of database: 757,237,578 Length adjustment: 115 Effective length of query: 42 Effective length of database: 445,001,193 Effective search space: 18690050106 Effective search space used: 18690050106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)