BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0016.0003.p (120 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_976399.1| dihydroneopterin aldolase [Bacillus cereus ATCC... 141 6e-33 ref|NP_654022.1| FolB, Dihydroneopterin aldolase [Bacillus anthr... 139 2e-32 ref|NP_829975.1| Dihydroneopterin aldolase [Bacillus cereus ATCC... 139 2e-32 ref|NP_240960.1| dihydroneopterin aldolase [Bacillus halodurans]... 134 5e-31 ref|NP_387959.1| dihydroneopterin aldolase [Bacillus subtilis] >... 131 4e-30 >ref|NP_976399.1| dihydroneopterin aldolase [Bacillus cereus ATCC 10987] gb|AAS39007.1| dihydroneopterin aldolase [Bacillus cereus ATCC 10987] Length = 120 Score = 141 bits (355), Expect = 6e-33, Method: Compositional matrix adjust. Identities = 65/119 (54%), Positives = 87/119 (73%) Query: 1 MDKMTLHRMEYYGYHGVFEEERKLGQRFYVDLELELDLQAAGRSDDLTLTVNYAEVHFLV 60 MDK+ +H ME+YGYHGVF EE KLGQRF VDL +ELDL+ AG SDDL +VNY E+ L Sbjct: 1 MDKIYIHDMEFYGYHGVFPEENKLGQRFKVDLTVELDLKQAGESDDLEQSVNYGELFELC 60 Query: 61 KKIVETKSFKLIEALAEYIASSLLDTYTVINAVTVKVTKPHPPFDIHFQGVTVELHRTR 119 +K+VE +++KL+E++AE IA+ +L Y I+ T+KV KP PP H++ V VE+ R R Sbjct: 61 RKVVEVRTYKLVESIAENIATDILKQYESISRCTIKVIKPDPPIPGHYRAVAVEITRER 119 >ref|NP_654022.1| FolB, Dihydroneopterin aldolase [Bacillus anthracis A2012] ref|NP_842641.1| dihydroneopterin aldolase [Bacillus anthracis str. Ames] gb|AAP24127.1| dihydroneopterin aldolase [Bacillus anthracis str. Ames] Length = 120 Score = 139 bits (350), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 65/119 (54%), Positives = 87/119 (73%) Query: 1 MDKMTLHRMEYYGYHGVFEEERKLGQRFYVDLELELDLQAAGRSDDLTLTVNYAEVHFLV 60 MDK+ +H ME+YGYHGVF EE KLGQRF VDL +ELDL+ AG SDDL +VNY E+ L Sbjct: 1 MDKIYIHDMEFYGYHGVFPEENKLGQRFKVDLTVELDLKRAGESDDLEHSVNYGELFELC 60 Query: 61 KKIVETKSFKLIEALAEYIASSLLDTYTVINAVTVKVTKPHPPFDIHFQGVTVELHRTR 119 +K+VE +++KL+E++AE IA+ +L Y I+ T+KV KP PP H++ V VE+ R R Sbjct: 61 RKVVEDRTYKLVESIAENIATDILKQYESISRCTIKVIKPDPPIPGHYRAVAVEITRER 119 >ref|NP_829975.1| Dihydroneopterin aldolase [Bacillus cereus ATCC 14579] gb|AAP07176.1| Dihydroneopterin aldolase [Bacillus cereus ATCC 14579] Length = 120 Score = 139 bits (350), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 65/119 (54%), Positives = 86/119 (72%) Query: 1 MDKMTLHRMEYYGYHGVFEEERKLGQRFYVDLELELDLQAAGRSDDLTLTVNYAEVHFLV 60 MDK+ +H ME+YGYHGVF EE KLGQRF VDL +ELDL+ AG SDDL +VNY E+ L Sbjct: 1 MDKIYIHDMEFYGYHGVFPEENKLGQRFKVDLTVELDLKRAGESDDLEHSVNYGELFELC 60 Query: 61 KKIVETKSFKLIEALAEYIASSLLDTYTVINAVTVKVTKPHPPFDIHFQGVTVELHRTR 119 +K+VE + +KL+E++AE IA+ +L Y I+ T+KV KP PP H++ V VE+ R R Sbjct: 61 RKVVEDRKYKLVESIAENIAADILKQYESISRCTIKVIKPDPPIPGHYRAVAVEITRER 119 >ref|NP_240960.1| dihydroneopterin aldolase [Bacillus halodurans] pir||F83661 dihydroneopterin aldolase folA [imported] - Bacillus halodurans (strain C-125) dbj|BAB03813.1| dihydroneopterin aldolase [Bacillus halodurans] Length = 114 Score = 134 bits (338), Expect = 5e-31, Method: Compositional matrix adjust. Identities = 63/114 (55%), Positives = 87/114 (76%) Query: 6 LHRMEYYGYHGVFEEERKLGQRFYVDLELELDLQAAGRSDDLTLTVNYAEVHFLVKKIVE 65 ++RME+YGYHGV+ EE KLGQRFYVDL LELDL+ AG SD L T+NYA+V+ + K++VE Sbjct: 1 MNRMEFYGYHGVYAEENKLGQRFYVDLTLELDLKRAGESDALVHTINYADVYKITKEVVE 60 Query: 66 TKSFKLIEALAEYIASSLLDTYTVINAVTVKVTKPHPPFDIHFQGVTVELHRTR 119 +S+KL+E++AE IA+ LL ++ + VTV VTKP PP H+ V VE+ R++ Sbjct: 61 GESYKLVESVAETIAAKLLASFEPLQFVTVTVTKPDPPIPGHYDSVAVEITRSK 114 >ref|NP_387959.1| dihydroneopterin aldolase [Bacillus subtilis] sp|P28823|FOLB_BACSU Dihydroneopterin aldolase (DHNA) pir||E37854 dihydroneopterin aldolase (EC 4.1.2.25) folA - Bacillus subtilis gb|AAA22698.1| ORF1 dbj|BAA05313.1| unknown [Bacillus subtilis] emb|CAB11854.1| dihydroneopterin aldolase [Bacillus subtilis subsp. subtilis str. 168] Length = 120 Score = 131 bits (330), Expect = 4e-30, Method: Compositional matrix adjust. Identities = 62/119 (52%), Positives = 82/119 (68%) Query: 1 MDKMTLHRMEYYGYHGVFEEERKLGQRFYVDLELELDLQAAGRSDDLTLTVNYAEVHFLV 60 MDK+ + ME+YGYHGVF EE KLGQRF VDL ELDL AG++DDL T+NYAE++ + Sbjct: 1 MDKVYVEGMEFYGYHGVFTEENKLGQRFKVDLTAELDLSKAGQTDDLEQTINYAELYHVC 60 Query: 61 KKIVETKSFKLIEALAEYIASSLLDTYTVINAVTVKVTKPHPPFDIHFQGVTVELHRTR 119 K IVE + KL+E LAE IA ++L + + TVKV KP PP H++ V +E+ R + Sbjct: 61 KDIVEGEPVKLVETLAERIAGTVLGKFQPVQQCTVKVIKPDPPIPGHYKSVAIEITRKK 119 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.322 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 169,822,387 Number of extensions: 5717152 Number of successful extensions: 14806 Number of sequences better than 1.0e-05: 184 Number of HSP's gapped: 14789 Number of HSP's successfully gapped: 184 Length of query: 120 Length of database: 757,237,578 Length adjustment: 84 Effective length of query: 36 Effective length of database: 529,169,262 Effective search space: 19050093432 Effective search space used: 19050093432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)