BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0012.0014.p (69 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|1MU4|A Chain A, Crystal Structure At 1.8 Angstroms Of The Ba... 84 1e-15 ref|NP_244433.1| phosphocarrier protein HPr (catabolite repressi... 83 2e-15 pdb|1K1C|A Chain A, Solution Structure Of Crh, The Bacillus Subt... 83 2e-15 ref|NP_391354.1| catabolite repression HPr-like protein [Bacillu... 83 2e-15 ref|NP_693386.1| catabolite repression HPr-like protein [Oceanob... 80 1e-14 >pdb|1MU4|A Chain A, Crystal Structure At 1.8 Angstroms Of The Bacillus Subtilis Catabolite Repression Histidine Containing Protein (Crh) pdb|1MU4|B Chain B, Crystal Structure At 1.8 Angstroms Of The Bacillus Subtilis Catabolite Repression Histidine Containing Protein (Crh) Length = 87 Score = 83.6 bits (205), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 39/67 (58%), Positives = 54/67 (80%) Query: 1 LFVQEANKFSSEIFVEKDDKKVNAKSIMGIMSLAISSGTEIFISADGADADQAVTALTSL 60 LFVQEAN+F+S++F+EKD KKVNAKSIMG+MSLA+S+GTE+ + A G D +A+ L + Sbjct: 21 LFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAY 80 Query: 61 VSKEELE 67 V +E L+ Sbjct: 81 VQEEVLQ 87 >ref|NP_244433.1| phosphocarrier protein HPr (catabolite repression) [Bacillus halodurans] sp|Q9K708|CRH_BACHD HPr-like protein crh (Catabolite repression HPr) pir||F84095 phosphocarrier protein HPr (catabolite repression) chr [imported] - Bacillus halodurans (strain C-125) dbj|BAB07285.1| phosphocarrier protein HPr (catabolite repression) [Bacillus halodurans] Length = 84 Score = 83.2 bits (204), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 40/64 (62%), Positives = 51/64 (79%) Query: 1 LFVQEANKFSSEIFVEKDDKKVNAKSIMGIMSLAISSGTEIFISADGADADQAVTALTSL 60 LFVQEAN+F+SEIF+EKD KKVNAKSIMG+MSLAI SG+ I + +G D +A+ AL + Sbjct: 21 LFVQEANRFTSEIFIEKDGKKVNAKSIMGLMSLAIGSGSTITLITEGNDEQEAMEALIAF 80 Query: 61 VSKE 64 + KE Sbjct: 81 IEKE 84 >pdb|1K1C|A Chain A, Solution Structure Of Crh, The Bacillus Subtilis Catabolite Repression Hpr Length = 84 Score = 82.8 bits (203), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 38/64 (59%), Positives = 52/64 (81%) Query: 1 LFVQEANKFSSEIFVEKDDKKVNAKSIMGIMSLAISSGTEIFISADGADADQAVTALTSL 60 LFVQEAN+F+S++F+EKD KKVNAKSIMG+MSLA+S+GTE+ + A G D +A+ L + Sbjct: 20 LFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAY 79 Query: 61 VSKE 64 V +E Sbjct: 80 VQEE 83 >ref|NP_391354.1| catabolite repression HPr-like protein [Bacillus subtilis] sp|O06976|CRH_BACSU HPr-like protein crh (Catabolite repression HPr) pir||D69607 catabolite repression protein crh [validated] - Bacillus subtilis emb|CAB08060.1| hypothetical protein [Bacillus subtilis] emb|CAB15479.1| catabolite repression HPr-like protein [Bacillus subtilis subsp. subtilis str. 168] Length = 85 Score = 82.8 bits (203), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 38/64 (59%), Positives = 52/64 (81%) Query: 1 LFVQEANKFSSEIFVEKDDKKVNAKSIMGIMSLAISSGTEIFISADGADADQAVTALTSL 60 LFVQEAN+F+S++F+EKD KKVNAKSIMG+MSLA+S+GTE+ + A G D +A+ L + Sbjct: 21 LFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAY 80 Query: 61 VSKE 64 V +E Sbjct: 81 VQEE 84 >ref|NP_693386.1| catabolite repression HPr-like protein [Oceanobacillus iheyensis HTE831] dbj|BAC14421.1| catabolite repression HPr-like protein [Oceanobacillus iheyensis HTE831] Length = 86 Score = 80.1 bits (196), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 37/60 (61%), Positives = 47/60 (78%) Query: 2 FVQEANKFSSEIFVEKDDKKVNAKSIMGIMSLAISSGTEIFISADGADADQAVTALTSLV 61 FVQEAN+FSS +F+EKDDKK+NAKSIMG+MSLAI+ G +I + A+G D D A+ L V Sbjct: 22 FVQEANRFSSHVFLEKDDKKINAKSIMGLMSLAITKGEQIKLIAEGPDEDTAIEHLEKYV 81 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.309 0.124 0.304 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 77,563,502 Number of extensions: 2009181 Number of successful extensions: 5695 Number of sequences better than 1.0e-05: 98 Number of HSP's gapped: 5715 Number of HSP's successfully gapped: 98 Length of query: 69 Length of database: 757,237,578 Length adjustment: 40 Effective length of query: 29 Effective length of database: 648,633,618 Effective search space: 18810374922 Effective search space used: 18810374922 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 120 (50.8 bits)