BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0004.0004.p (80 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_240940.1| BH0074~unknown conserved protein in B. subtilis... 77 2e-13 ref|NP_654006.1| hypothetical protein predicted by GeneMark [Bac... 71 6e-12 ref|NP_829960.1| hypothetical protein [Bacillus cereus ATCC 1457... 69 4e-11 ref|NP_690989.1| hypothetical protein OB0068 [Oceanobacillus ihe... 67 9e-11 ref|NP_387941.1| yabP [Bacillus subtilis] >gi|586887|sp|P37558|Y... 66 2e-10 >ref|NP_240940.1| BH0074~unknown conserved protein in B. subtilis [Bacillus halodurans] pir||B83659 hypothetical protein BH0074 [imported] - Bacillus halodurans (strain C-125) dbj|BAB03793.1| BH0074 [Bacillus halodurans] Length = 103 Score = 76.6 bits (187), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 38/80 (47%), Positives = 52/80 (65%) Query: 1 MHSRKQLELTGVQNVESFDSEEFLLRTELGHLTIRGNHLHIKXXXXXXXXXXXXXXVHSL 60 M +RK L++TGV+ VESFD+EEFLL TE+G L+IRG +LH+K + + Sbjct: 24 MRNRKTLDITGVKQVESFDNEEFLLETEMGFLSIRGRNLHMKNLNVEEGLVSIEGKIFDM 83 Query: 61 IYLDPGAQGKNKGILGKLFK 80 +YL+ G K+KG GKLFK Sbjct: 84 VYLEQGQGEKSKGFFGKLFK 103 >ref|NP_654006.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_842626.1| yabP protein [Bacillus anthracis str. Ames] ref|NP_976384.1| yabP protein [Bacillus cereus ATCC 10987] gb|AAP24112.1| yabP protein [Bacillus anthracis str. Ames] gb|AAS38992.1| yabP protein [Bacillus cereus ATCC 10987] Length = 102 Score = 71.2 bits (173), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 36/80 (45%), Positives = 47/80 (58%) Query: 1 MHSRKQLELTGVQNVESFDSEEFLLRTELGHLTIRGNHLHIKXXXXXXXXXXXXXXVHSL 60 M R+ +++TGV+ VESFDSEEFLL T +G LTIRG +L +K VH + Sbjct: 23 MRGRRVIDITGVKQVESFDSEEFLLETVMGFLTIRGQNLQMKNLDVEKGVVSIKGKVHEM 82 Query: 61 IYLDPGAQGKNKGILGKLFK 80 +Y+D K KG KLFK Sbjct: 83 LYIDENQGEKTKGFFSKLFK 102 >ref|NP_829960.1| hypothetical protein [Bacillus cereus ATCC 14579] gb|AAP07161.1| hypothetical protein [Bacillus cereus ATCC 14579] Length = 102 Score = 68.9 bits (167), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 35/80 (43%), Positives = 47/80 (58%) Query: 1 MHSRKQLELTGVQNVESFDSEEFLLRTELGHLTIRGNHLHIKXXXXXXXXXXXXXXVHSL 60 M R+ +++TGV+ VESFDSEEFLL T +G LTIRG +L +K V+ + Sbjct: 23 MRGRRIIDITGVKQVESFDSEEFLLETVMGFLTIRGQNLQMKNLDVEKGIVSIKGKVNEM 82 Query: 61 IYLDPGAQGKNKGILGKLFK 80 +Y+D K KG KLFK Sbjct: 83 LYIDENQGEKTKGFFSKLFK 102 >ref|NP_690989.1| hypothetical protein OB0068 [Oceanobacillus iheyensis HTE831] dbj|BAC12024.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 100 Score = 67.4 bits (163), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 32/80 (40%), Positives = 49/80 (61%) Query: 1 MHSRKQLELTGVQNVESFDSEEFLLRTELGHLTIRGNHLHIKXXXXXXXXXXXXXXVHSL 60 +++RK LE+TGV+ V+SFD+EEF+L T +G+L +RG +L +K ++ L Sbjct: 21 INNRKDLEITGVKEVDSFDNEEFILETVMGYLIVRGQNLQLKNLDVTEGIVTIKGKIYEL 80 Query: 61 IYLDPGAQGKNKGILGKLFK 80 Y+D Q K KG KLF+ Sbjct: 81 SYVDEQQQEKAKGFFSKLFR 100 >ref|NP_387941.1| yabP [Bacillus subtilis] sp|P37558|YABP_BACSU Hypothetical protein yabP pir||S66090 yabP protein - Bacillus subtilis dbj|BAA05295.1| unknown [Bacillus subtilis] emb|CAB11836.1| yabP [Bacillus subtilis subsp. subtilis str. 168] Length = 100 Score = 66.2 bits (160), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 35/80 (43%), Positives = 47/80 (58%) Query: 1 MHSRKQLELTGVQNVESFDSEEFLLRTELGHLTIRGNHLHIKXXXXXXXXXXXXXXVHSL 60 M RK L+++GV++VESFD+EEFLL T +G L++RG +L +K V L Sbjct: 21 MKGRKHLDISGVKHVESFDNEEFLLETVMGMLSVRGQNLQMKNLDVEKGIVSIKGRVFDL 80 Query: 61 IYLDPGAQGKNKGILGKLFK 80 +YLD K KG KLFK Sbjct: 81 VYLDEQQGDKAKGFFSKLFK 100 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.320 0.140 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 96,568,467 Number of extensions: 2353107 Number of successful extensions: 2605 Number of sequences better than 1.0e-05: 5 Number of HSP's gapped: 2605 Number of HSP's successfully gapped: 5 Length of query: 80 Length of database: 757,237,578 Length adjustment: 50 Effective length of query: 30 Effective length of database: 621,482,628 Effective search space: 18644478840 Effective search space used: 18644478840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)