BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0004.0003.p (92 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_654005.1| S4, S4 RNA-binding domain [Bacillus anthracis A... 100 7e-21 ref|NP_387940.1| similar to hypothetical proteins [Bacillus subt... 100 2e-20 ref|ZP_00184301.1| hypothetical protein Exigu027801 [Exiguobacte... 96 4e-19 ref|NP_240939.1| BH0073~unknown conserved protein [Bacillus halo... 94 1e-18 ref|NP_469593.1| highly similar to B. subtilis YabO protein [Lis... 89 3e-17 >ref|NP_654005.1| S4, S4 RNA-binding domain [Bacillus anthracis A2012] ref|NP_829959.1| Heat shock protein 15 [Bacillus cereus ATCC 14579] ref|NP_842625.1| S4 domain protein [Bacillus anthracis str. Ames] ref|NP_976383.1| S4 domain protein [Bacillus cereus ATCC 10987] gb|AAP07160.1| Heat shock protein 15 [Bacillus cereus ATCC 14579] gb|AAP24111.1| S4 domain protein [Bacillus anthracis str. Ames] gb|AAS38991.1| S4 domain protein [Bacillus cereus ATCC 10987] Length = 91 Score = 100 bits (250), Expect = 7e-21, Method: Compositional matrix adjust. Identities = 49/90 (54%), Positives = 65/90 (72%) Query: 1 MRLDKFLKVSRLIKRRTVAKDVSEQGRVLINGRESKPSSTVKIGDEITVQFGQXXXXXXX 60 MRLDKFLKVSRLIKRRT+AK+V++QGR+ ING+ +K SS VK+ DE+T++FGQ Sbjct: 1 MRLDKFLKVSRLIKRRTLAKEVADQGRISINGQVAKASSDVKVADELTIRFGQKIVTVKI 60 Query: 61 XXXXXXXRKDEAAGMYTLLREEPVAKTSGL 90 +K++AA MY+L+REE V GL Sbjct: 61 NELKETTKKEDAANMYSLVREEKVKAEEGL 90 >ref|NP_387940.1| similar to hypothetical proteins [Bacillus subtilis] sp|P37557|YABO_BACSU Hypothetical protein yabO pir||S66089 conserved hypothetical protein yabO - Bacillus subtilis dbj|BAA05294.1| unknown [Bacillus subtilis] emb|CAB11835.1| yabO [Bacillus subtilis subsp. subtilis str. 168] Length = 86 Score = 100 bits (248), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 49/84 (58%), Positives = 63/84 (75%) Query: 1 MRLDKFLKVSRLIKRRTVAKDVSEQGRVLINGRESKPSSTVKIGDEITVQFGQXXXXXXX 60 MRLDKFLKVSRLIKRRT+AK+V++QGR+ ING ++K SS VK GDE+TV+FGQ Sbjct: 1 MRLDKFLKVSRLIKRRTLAKEVADQGRISINGNQAKASSDVKPGDELTVRFGQKLVTVQV 60 Query: 61 XXXXXXXRKDEAAGMYTLLREEPV 84 +K+EAA MYT+L+EE + Sbjct: 61 NELKDTTKKEEAANMYTILKEEKL 84 >ref|ZP_00184301.1| hypothetical protein Exigu027801 [Exiguobacterium sp. 255-15] Length = 90 Score = 95.5 bits (236), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 46/84 (54%), Positives = 61/84 (72%) Query: 1 MRLDKFLKVSRLIKRRTVAKDVSEQGRVLINGRESKPSSTVKIGDEITVQFGQXXXXXXX 60 MRLDKFLKVSRLIKRRT+AK+V++QGR+ ING +K SSTV +GDE+T++FG Sbjct: 1 MRLDKFLKVSRLIKRRTLAKEVADQGRIKINGLVAKASSTVAVGDEMTIRFGNKIVTVQI 60 Query: 61 XXXXXXXRKDEAAGMYTLLREEPV 84 +K+EA+ MY ++REE V Sbjct: 61 DSIKEHAKKEEASDMYQIIREEKV 84 >ref|NP_240939.1| BH0073~unknown conserved protein [Bacillus halodurans] sp|Q9KGI8|Y073_BACHD Hypothetical protein BH0073 pir||A83659 hypothetical protein BH0073 [imported] - Bacillus halodurans (strain C-125) dbj|BAB03792.1| BH0073 [Bacillus halodurans] Length = 88 Score = 93.6 bits (231), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 44/87 (50%), Positives = 61/87 (70%) Query: 1 MRLDKFLKVSRLIKRRTVAKDVSEQGRVLINGRESKPSSTVKIGDEITVQFGQXXXXXXX 60 MRLDKFLKVSRLIKRRT+AK+V EQGR+ +NG +K + VK GDE+ ++FGQ Sbjct: 1 MRLDKFLKVSRLIKRRTLAKEVCEQGRITVNGNVAKAGTVVKEGDELVIRFGQKLVTVEI 60 Query: 61 XXXXXXXRKDEAAGMYTLLREEPVAKT 87 RK+EA+ +Y + +EEP++K+ Sbjct: 61 TNVKETVRKEEASTLYEVKKEEPISKS 87 >ref|NP_469593.1| highly similar to B. subtilis YabO protein [Listeria innocua] pir||AI1463 B. subtilis YabO protein homolog lin0248 [imported] - Listeria innocua (strain Clip11262) emb|CAC95481.1| lin0248 [Listeria innocua] Length = 92 Score = 89.4 bits (220), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 42/82 (51%), Positives = 58/82 (70%) Query: 1 MRLDKFLKVSRLIKRRTVAKDVSEQGRVLINGRESKPSSTVKIGDEITVQFGQXXXXXXX 60 MRLDK+LKVSRLIKRRTVAK+V+E+GR+ +NG +KP + VK GDE+ ++FG Sbjct: 5 MRLDKYLKVSRLIKRRTVAKEVAEKGRIAVNGVTAKPGTNVKSGDELVIRFGPKIVTAKI 64 Query: 61 XXXXXXXRKDEAAGMYTLLREE 82 +K++A MYT+L+EE Sbjct: 65 ERLEENAKKEQATEMYTILKEE 86 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.133 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 95,655,943 Number of extensions: 2392555 Number of successful extensions: 6231 Number of sequences better than 1.0e-05: 29 Number of HSP's gapped: 6231 Number of HSP's successfully gapped: 29 Length of query: 92 Length of database: 757,237,578 Length adjustment: 60 Effective length of query: 32 Effective length of database: 594,331,638 Effective search space: 19018612416 Effective search space used: 19018612416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)