BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0003.0001.p
         (175 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF 
           2,715,099 sequences; 757,237,578 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|ZP_00098443.1| COG2244: Membrane protein involved in the exp...    57   2e-07

>ref|ZP_00098443.1| COG2244: Membrane protein involved in the export of O-antigen and
           teichoic acid [Desulfitobacterium hafniense]
          Length = 111

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 42/67 (62%)

Query: 102 AAALTPFKTLHSAWSLSLYIGFGQIIWIMVQTYMLNTVSLIHICYMSLGMLIQIVTLLPS 161
           A  L  F     AW+ SLYIGF  II+I V+ Y++     IH+ Y+   +LIQ +TLLPS
Sbjct: 45  ANRLNLFADKDWAWTYSLYIGFILIIFIAVEAYIIKGFVAIHLGYIFGALLIQALTLLPS 104

Query: 162 VQRYFVL 168
           VQRY+ L
Sbjct: 105 VQRYYTL 111


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 24, 2004  1:53 AM
  Number of letters in database: 757,237,578
  Number of sequences in database:  2,715,099
  
Lambda     K      H
   0.326    0.138    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 2715099
Number of Hits to DB: 202,314,213
Number of extensions: 5417555
Number of successful extensions: 11913
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 11913
Number of HSP's successfully gapped: 1
Length of query: 175
Length of database: 757,237,578
Length adjustment: 117
Effective length of query: 58
Effective length of database: 439,570,995
Effective search space: 25495117710
Effective search space used: 25495117710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 121 (51.2 bits)