BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0599.0122.p
         (86 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

lin0914 [G] COG1440 Phosphotransferase system cellobiose-specifi...    56   1e-08

>lin0914 [G] COG1440 Phosphotransferase system cellobiose-specific
          component IIB
          Length = 301

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 7/63 (11%), Positives = 17/63 (26%)

Query: 20 ARGEAEIENYIDDIDALLVGPHLAYIVDEIEELTRDSDVKVLLMKPSYYSTLDGEAALND 79
             +A+   +              Y+      +     +  L+ K +  S  D E  +  
Sbjct: 36 TSRKAQTTRHRIVGIHTEGAYQAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFV 95

Query: 80 LLS 82
          +  
Sbjct: 96 VEG 98


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.316    0.139    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 5,274,567
Number of extensions: 178014
Number of successful extensions: 426
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 426
Number of HSP's successfully gapped: 1
Length of query: 86
Length of database: 38,378,431
Length adjustment: 56
Effective length of query: 30
Effective length of database: 31,919,727
Effective search space: 957591810
Effective search space used: 957591810
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 109 (46.6 bits)