BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0579.0054.p
         (89 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAC2808 [V] COG1680 Beta-lactamase class C and other penicillin ...    55   2e-08

>CAC2808 [V] COG1680 Beta-lactamase class C and other penicillin binding
           proteins
          Length = 252

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 0/78 (0%), Positives = 0/78 (0%)

Query: 8   GTSICTIEDNGHAVWFKIDAKSAAKTMRVEVPSSGGVIVYDGKGMPVYSSIVNKDKSVVL 67
                                                                       
Sbjct: 655                                                              714

Query: 68  PEGGMIVFGGEAGDVFQI 85
                             
Sbjct: 715                    732


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.316    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 7,216,537
Number of extensions: 278131
Number of successful extensions: 522
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 522
Number of HSP's successfully gapped: 1
Length of query: 89
Length of database: 38,378,431
Length adjustment: 59
Effective length of query: 30
Effective length of database: 31,573,725
Effective search space: 947211750
Effective search space used: 947211750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 109 (46.6 bits)